KEGG   Desulfofundulus kuznetsovii: Desku_1417Help
Entry
Desku_1417        CDS       T01499                                 

Definition
(GenBank) Multifunctional protein surE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00230  Purine metabolism
dku00240  Pyrimidine metabolism
dku00760  Nicotinate and nicotinamide metabolism
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desku_1417
   00240 Pyrimidine metabolism
    Desku_1417
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Desku_1417
Enzymes [BR:dku01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Desku_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AEG15000
UniProt: F6CQX5
Position
complement(1433990..1434757)
Genome map
AA seq 255 aa AA seqDB search
MIVLLSNDDGIHAPGLKALAESLQELGDLYIVAPDRERSATGHGITVHRPLRLETISIPG
IKAMAWAVDGTPADCVKLAVEDLLPNPPAVVVAGINQGPNLGTDVLYSGTVSAAIEGTIN
GFPALAISLTSYGSHDFTTAAEVARKVVNLTMQKGLPRGTLLNINVPAAEPRGIRFTRLG
NRRYVNIFHKRTDPRGRIYYWMAGEPLDLEENGDDTDVQAIKQNFISITPIQLDLTDYQS
LQILRQQWEEITFHF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgttttgctcagcaatgatgacggcatccacgcccccggtttaaaagccctggcc
gaaagcctgcaggaacttggcgatctttatatcgtggccccggaccgggaacgcagcgct
accggccacgggattaccgttcaccgccccctgcgcctggaaacgattagtattccaggc
attaaggccatggcttgggccgtggatggaacaccggccgattgtgttaagctggccgtg
gaggatctgttgcccaatcccccggccgtggtggtcgctggcattaaccagggacctaat
ttgggcaccgatgtcctttattccggaacggtttccgcagccatcgaaggaactatcaat
ggttttccggccctggccatttccttaaccagctatggcagccatgattttaccacggct
gcggaagtagcccggaaggtggtcaacctgaccatgcaaaagggtctgccccgcgggaca
ttattaaatattaatgtaccggcggctgagccacggggcatacgctttacccgcctgggc
aaccggcggtatgtgaatatctttcataaacgtactgatccccgcgggcgcatttattac
tggatggccggagaaccgctggacctggaagaaaacggcgatgacacggacgtgcaggcc
ataaaacaaaattttatctccataacacccatccagcttgatctgaccgactaccagtca
ctgcaaattcttcgccagcagtgggaggagataacttttcatttttaa

DBGET integrated database retrieval system