KEGG   Desulfofundulus kuznetsovii: Desku_1943Help
Entry
Desku_1943        CDS       T01499                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00620  Pyruvate metabolism
dku01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desku_1943
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dku02000]
    Desku_1943
Enzymes [BR:dku01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Desku_1943
Transporters [BR:dku02000]
 Other transporters
  Primary active transporters [TC:3]
   Desku_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEG15505
UniProt: F6CL62
Position
complement(1936918..1938789)
Genome map
AA seq 623 aa AA seqDB search
MGLKITDTTLRDGHQSLWATRMRTQDMLPILEKLDAVGYHSLEVWGGATFDVCMRYLNED
PWERLRTLKKHIKRTPLQMLLRGQSLVGYQHYPDDVVEAFINKMVENGIDIIRIFDALND
LRNFEAPMRVASKTGAHIQAAVVYTISPVHTTEHYVETAVSLAQMGAHSICIKDMAGLLT
PYKAYELVKLIKERVGLPVQLHSHYIGGLALGAYLKAAEAGVDVVDTASVPLAFGSSQPP
VETVVRALQGTPYDTGLDLHLLFEIAAYFEDLRKSLGYERGVTRINDMRVFEHQVPGGMI
SNLVTQLEEQKALHRLPEVLAEIPRVRAELGYPPLVTPTSQIVGTQAVLNVLTGERYKLI
PGEVRAYVEGLYGRPPAPIDPDVARKILGDREPITCRPADLLEPKMDKIREEIKHLAKSE
EDFISYALFPQVAKRFFENRNRPGHQPVDSTAPLRNGAREQKTGRKEDGSMNLQEIKELI
KLIDQTAIAELSLESAGVKVAIRKAGAQGTMPAPAGEDSPVSPPARETAAPPVPAPEKSI
DTTGLTVIRAPMVGTFYRAPAPDAPPFVQVGDVVEKGQTLCIIEAMKLMNEIESEVAGEI
VEILVENGQPVEYGQELFLIREK
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaaagatcaccgacactaccctgcgcgatggccaccagagcctctgggccacc
cgcatgcgtactcaagatatgctgcccatcctggaaaaactggatgcggtaggctatcat
tccctggaagtgtggggcggggccacttttgacgtttgcatgcgttatttgaacgaagat
ccctgggagcgtttgcggactttaaaaaagcacattaagcgcacgcccttgcagatgctt
ttacgtggtcagtccctggtgggttaccagcattatcccgatgatgtggtcgaggccttt
attaataagatggtggaaaacggcatagatattatccgcatctttgacgccttgaacgac
ctgcgcaactttgaagcacccatgcgggtggcttcaaagacgggggcacacatccaggcg
gcggtggtttataccatcagcccggtacacaccaccgagcactatgtggaaacagcggtc
agcctggcccagatgggagctcattccatctgcattaaagatatggccgggctgctcact
ccttataaagcttacgaactggtaaaactgattaaggaacgggtcggtctgcccgtacag
ctgcacagccactacattggcggcctggccctgggggcctacctcaaggcggccgaggcg
ggggtggatgtggtggataccgcctcggtacccctggcctttggttcttcccagcctccg
gtggaaacggtggtgcgggcgttgcagggcacgccctacgataccggcctggatctccac
ttgctttttgaaattgccgcttactttgaagacctgcgcaagtcccttggttacgagcgg
ggggtcacccgcatcaacgacatgcgggtctttgaacaccaggtacccggagggatgatt
tccaacctggttacccagctggaagaacaaaaagccctgcatcgcctgcccgaggtgctg
gcggaaattccccgggtgcgggcggagctgggttacccgcccctggttactcccaccagc
cagatcgtgggcacccaggccgtgctgaacgttctcaccggagaacgctacaaactcatt
cccggcgaggtgcgggcctatgtagaagggctttacggcaggccgccggcccccatagat
ccggatgtggcccgaaagattttgggagacagggaacccattacctgtcgccccgccgat
ttactggaacccaaaatggataaaataagagaagagatcaaacacctggcaaagtcggaa
gaagatttcatttcctacgccctgtttccccaggtggcgaagagattctttgaaaatcgc
aaccggccgggtcaccagcccgtggattccaccgcacccttgcgcaacggagcccgggag
caaaaaaccggccgtaaggaggatggaagcatgaacttacaggaaatcaaggagttaatt
aaactaattgaccagacggccattgccgagttatccctggagagtgcgggggtgaaagtg
gccataaggaaagccggcgcgcaagggacgatgcctgcacctgcgggtgaggattccccg
gtgtcgccgccggcccgggaaacggctgccccaccggtaccagccccggaaaaatctatt
gatactaccggtcttaccgtgatcagggctcccatggtaggcaccttttaccgcgccccg
gctcccgatgccccgccctttgtccaggtgggagatgtggtggagaagggccagacgctt
tgtattattgaggccatgaaactgatgaacgaaattgaatcagaagtggccggtgaaatt
gtagaaatcctggtggaaaacggccagcccgtggagtacgggcaggagctgttcttgatt
cgggaaaaatag

DBGET integrated database retrieval system