KEGG   Desulfofundulus kuznetsovii: Desku_2618Help
Entry
Desku_2618        CDS       T01499                                 

Definition
(GenBank) Glycyl-tRNA synthetase beta subunit
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dku00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desku_2618
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dku01007]
    Desku_2618
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dku03016]
    Desku_2618
Enzymes [BR:dku01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Desku_2618
Amino acid related enzymes [BR:dku01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Desku_2618
Transfer RNA biogenesis [BR:dku03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Desku_2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AEG16142
UniProt: F6CHI2
Position
complement(2601147..2603252)
Genome map
AA seq 701 aa AA seqDB search
MHTQDFLLEIGMEEMPARFLNPALEQLKELAANLLRENRLPFGEIKTYGTPRRLALYVHN
LAGMQESLIQEVKGPAAKVAFNPAGEPTRAALGFAKSQGVDVSQLVVKNLGPVEYVFAVK
RQEGRPATEVLAGLCPSLIAGLHFPKPMRWGSLEVRFARPIRWLVALYGDQVIDFSYAGL
RSGRITCGHRFLSQGLLEIPHASKYFEVMERGRVVVDPERRREMIWNQVQELAARAGGQV
VPDEELLTEVTNLVEYPLALCGSFDESFLQLPAEVLVTPMREHQRYFPVRDSGGKLLPRF
IAISNGNEEHLDTVRAGNEKVLRARLADAAFFWKEDLATPLAQRVEALKKVVWQESLGTV
YDKVERLIGLSRYLARVFAAGEKETEQVLRAAYLAKADLVTSMVYEFPELQGVMGREYAL
ASGEDPAVARAIYEHYLPRFSGDELPVSTPGRILSLADKMDTLVGCFATGIEPTGSQDPY
GLRRQALGICHICLEGELVLSLRGLIEQAYEQYRGRVELKLRREQVISHLMDFFAQRLKG
IFADRGLSYDTVEAVLAAGFDDLTGAWQRAQAVEAFRDEPHFEAVLTAFTRAHNLSRRHG
STTVDPAVLVHPAEVALYQKLKEVQEEVARNLAARDYRGALAAMASLRPGVDQFFDAVMV
MVDDEKIRNNRLSLLKGVATLALGVADLSKLVAAPGDKLYT
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgcatacccaggatttcttactggaaattggtatggaggaaatgccggcccggttttta
aacccggccctggaacaattgaaggaactggcagcgaacctgttgcgggagaaccggctg
ccctttggtgaaattaagacctatggcactccccggcgcctggccctctacgtccacaac
ctggccggtatgcaggaatccctgatccaggaggtaaaagggccggcagctaaagtggcc
ttcaatccggccggggagccaacccgggcggccctgggttttgcgaaaagccagggggtg
gatgtttcccagctggtggtgaaaaacctgggccccgtggaatatgtatttgcagtgaag
cgtcaggagggccggcccgcaacggaagtgctggccgggctctgcccctctttaattgcc
ggtttgcatttccccaaacccatgcgctggggatctctggaggtgcgttttgcccgtccc
attcgctggctggtggccctctacggtgatcaggtgattgatttctcctatgccgggctc
cggtccgggcggattacctgcgggcaccgctttttaagccagggtcttctggaaatcccc
catgcaagcaagtatttcgaggttatggagcggggccgggtagtggtagatcctgagcgg
cgccgggagatgatctggaaccaggtacaagagctggctgcccgggccggcgggcaggtg
gtgcctgacgaagagctgctgacggaagtaaccaatctggtggaatatcccttagccctt
tgcggcagctttgacgagagctttttgcaattgccggccgaggtgctggtaacgcccatg
cgggaacaccagcgctattttcccgtgcgggattccgggggcaaactgctgccccgcttt
attgccatcagcaacggcaatgaggagcacctggataccgtccgggccgggaatgaaaag
gtgctgcgggcccgcctggccgatgccgctttcttctggaaggaagatctggccacaccc
ctggcccaacgggtagaggcgttaaaaaaggtcgtctggcaggaaagtctgggtacggtc
tacgacaaggtggaacgccttatcggcctgtcccgttacctggcccgtgtctttgccgcc
ggcgaaaaagaaacggaacaggtgctgcgggcggcatacctggccaaggccgacctggtt
accagcatggtctacgaatttcccgaattgcagggcgtcatgggccgggaatacgccctg
gcttccggggaggatccggcggttgcccgggccatttacgagcattacctgccccgtttc
tccggcgatgagctgccggttagtaccccgggacggatattgagcctggccgataaaatg
gacaccctggttggttgttttgccaccggcatcgagcccaccggttcccaggatccctac
ggcctgcgccggcaggccctggggatatgccatatctgcctggagggggaactggtgctt
tccttgcgcggtttgattgagcaggcctacgaacagtaccgcgggcgggtggaattgaag
ctgagaagagaacaggttatatcccacctgatggacttcttcgcccagcgcctgaaagga
atttttgccgaccgggggttatcctacgacacggtggaggcggtgctggcggctggtttt
gatgatctcaccggcgcctggcagcgcgcccaggctgtggaggcgttccgggacgaaccc
cattttgaagcggtgctcacggcctttacccgcgcccataatttgtcccgcaggcacggc
tccaccacggtggacccggctgtcctcgtgcacccggcagaagtagccctgtaccagaaa
ttaaaagaggtgcaggaagaggttgcccggaacctggccgcccgggattaccggggggcg
ctggcggccatggcttctttgcggccgggggtagatcagttttttgatgccgtcatggtc
atggtggatgatgagaaaatccggaacaaccgtctcagcctgctcaagggagtggccacc
ctggccctgggtgtggccgatctgagcaaactggttgccgcaccgggggacaaattgtat
acatga

DBGET integrated database retrieval system