KEGG   Delphinapterus leucas (beluga whale): 111162747Help
Entry
111162747         CDS       T05885                                 

Gene name
MTMR3
Definition
(RefSeq) myotubularin-related protein 3 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle04070  Phosphatidylinositol signaling system
dle04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111162747 (MTMR3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111162747 (MTMR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111162747 (MTMR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111162747 (MTMR3)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111162747 (MTMR3)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     111162747 (MTMR3)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     111162747 (MTMR3)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    111162747 (MTMR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 111162747
NCBI-ProteinID: XP_022406603
UniProt: A0A2Y9LMW3
Position
Unknown
AA seq 1202 aa AA seqDB search
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKIIRCQFSTFEQCQEWLKRLNNAVRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVASFRSWKRIPAVVYRHQSNGAVIARCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNSPRDFPNAGDLSDVEFDSSLSNAS
GAESLAVQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDRDQRPVLAHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPSTPVDDSCAPYPAPGTSP
DDPPLSRLPKTRSFDNLTTACENTVPLASRRSSDPSLNEKWQEHRRSLELSTLAGPGEEL
LDPDSLGKPAKVLGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHREMQEVKEEALL
EEGRRGKTPECPAIVLHQEPELGDAALRSHHPGTSLLVLSQGIPEQQGGHSILPSSLQEP
PQGEDAQEVPVEQSRIGAITQDREEAVLPISVDVKVGFGTSQSSSLPSQVSFETRGPNAD
SSMDMLVEDKVRSESGPQGHDRPCLPARVSSGRFSGKEELPQAMEPRPSERSLAERPQVG
SLVYRTSPSSTQSPAHSPCALPLAECKEGLVCNGAPETENKASEQLPGHSTLQKYPTPNG
HCANGETGRSKDSLSRQLSATSCSSAHLHSRNLHHKWLHSHSGRASATGSPDQPSRSHLD
DDGMPLYTDTIQQRLRQIESGHQQEVETLKKQVQELRSRLESQYLTSSLRFNGDFGDEVT
SIPDSESILDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLAS
RKHHCRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAAT
SN
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagagactcggcacagccttgagtgcatccaggccaatcagatctttcccagg
aagcagctgatccgggaggatgagaatcttcaggttcctttccttgaacttcatggagaa
agcacagagtatgtgggccgtgctgaggatgccatcattgccctttctaattacagactt
cacatcaagttcaaggagtctctggttaacgttccattacagcttatagaaagtgttgaa
tgccgagatatatttcagcttcatttgacttgcaaagactgcaaaattatcaggtgtcag
ttctcaacctttgagcagtgtcaagagtggctgaaaagactgaacaatgcagtccgacca
cctgctaaaatagaagatctcttctcatttgcataccatgcttggtgcatggaggtctac
gccagtgaaaaagagcaacatggagacctgtgcaggccaggggagcacgtaacatcaagg
tttaaaaacgaagtggagcggatgggttttgatatgaacaacgcctggaggatttccaac
atcaatgaaaagtacaagctgtgtggtagctatccacaggagctcatagtgcctgcttgg
atcactgacaaagaactagaaagtgtcgcaagcttcaggtcctggaagcgcatccccgcc
gtcgtctacaggcaccagagcaatggagctgtcattgcccgctgtggacagccggaggtc
agctggtggggctggcgaaatgctgatgatgagcacctggtgcagtcagtagccaaagct
tgtgcctccgactcccgatccagtggcagcaagctgtcaactaggaacagtccccgagac
ttccccaatgcaggagacctttctgatgtggagtttgattcttctctgtcaaatgcttca
ggagcagagagtttagctgtccaaccacagaagcttttgatcttggatgcacgctcctat
gcagcagctgtggcgaaccgagccaaaggaggaggctgtgaatgcccagagtattacccg
aactgtgaagttgtttttatggggatggcaaatattcattcaattcggaggagttttcag
tctctgcgattgctgtgcacacagatgccagatccgggaaattggctctcagctcttgaa
agtacaaaatggctccatcacctgtctgtgcttctgaagtcagcacttctggtagtgcat
gctgtggatcgtgatcaacgaccagtgctagcgcactgctcggatggctgggaccgcacc
ccccagattgtggcattggctaagctcttgctggacccttattaccgaaccatagagggt
ttccaggtcctcgtggagatggagtggctggattttggccacaagtttgctgaccggtgt
ggtcatggggagaactcggatgatctgaacgagcgttgcccagtgtttttacagtggctg
gactgtgttcatcagcttcagaggcaatttccgtgctcttttgagttcaatgaagcattc
cttgtgaaactggtgcagcatacctattcctgcctgtttggaacattcctgtgcaacaac
gccaaggagagaggggaaaaacatactcaggaacggacgtgttctgtgtggtcgctgctt
cgggcgggcaacaaggctttcaaaaacctactgtattcctctcagtcagaagccgtgctg
taccctgtgtgccacgtgcgtaacctgatgctgtggagtgcagtgtacctgccctgccca
tccccgtccacccctgtggacgacagctgtgcaccatacccagcccctggcaccagccct
gatgatccacctctgagtcggctaccaaagactagatcatttgacaatctgaccaccgcc
tgcgagaacacagtgcctctagccagccggcgcagcagtgacccaagcctgaatgagaag
tggcaggagcaccgtcgttcgctggaactgagcactctggctggtcctggagaggagctt
ctggatcctgacagcctggggaagccagccaaagtgctgggtggcgccgagctgtctgtt
gcagctggagtagctgaggggcagatggagaatatcctgcaagaggccaccaaagaggag
agtggggtagaggagcctgcccacagggagatgcaggaggtcaaagaggaggctctttta
gaagaggggaggagagggaagacccctgagtgcccagccattgtgcttcatcaagagcca
gaactgggtgatgctgctctaaggagccaccatccaggcaccagccttcttgtgctctca
cagggtattcctgagcagcagggtgggcacagtattctccccagttctctccaggagccc
ccccagggagaggatgcccaggaggtccctgtggaacagtctcgaataggagctatcaca
caggacagggaggaggcagtccttccaatctcagtagatgtgaaagttggctttggtacc
tcacagtcaagttctctgccctcccaagtttcatttgagaccagaggaccaaatgcagat
agttccatggacatgttagtggaagataaagtgaggtcagaaagtggtccccaaggccat
gatagaccttgcttacctgccagggtaagcagtggcaggttcagtggcaaggaggagctt
cctcaagccatggagcccaggccttcagagaggagcctggctgagaggccccaagtggga
tctctggtgtataggacttcccccagcagcacccagagcccagcgcattctccttgtgcc
ttgcctttagctgaatgtaaagaggggcttgtgtgcaatggtgctccagagactgaaaat
aaggcctcagagcagctcccagggcatagtaccctccagaagtaccctacccccaatggg
cactgtgccaatggggagactggtaggagcaaggactcactgagccgccagctgtctgcc
acaagctgcagctctgcccacttacactcgaggaacttgcatcacaagtggctgcacagc
cactcggggagggcgtctgcaactggcagccctgaccagccttcccgcagccacctggac
gatgacggcatgcctctgtacacggacactatccaacagcgcctgcgtcagattgagtcg
ggccaccagcaggaagtggagaccttgaagaaacaagtccaggagctgaggagtcgcctg
gagagccagtacctgaccagctccctacgcttcaatggggactttggggatgaagtgact
tcaattcctgactcggaaagcattctggatcagaactgtttgtctcgctgcagcacagag
attttctctgaagccagctgggagcaggtggataaacaggacacggagatgacccgttgg
ctccctgaccacctggccgcccactgctatgcatgcgacagcgccttctggcttgccagc
aggaagcaccactgcaggaattgtgggaacgtattctgctccagttgttgtaaccagaag
gttccagttcccagccaacagctctttgaacctagtcgagtgtgcaagtcttgttatagc
agcctgcatcccacaagctccagcattgaccttgaactggataagcccattgctgccact
tcaaactga

DBGET integrated database retrieval system