KEGG   Delphinapterus leucas (beluga whale): 111163628Help
Entry
111163628         CDS       T05885                                 

Gene name
MTMR4
Definition
(RefSeq) myotubularin-related protein 4 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle04070  Phosphatidylinositol signaling system
dle04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111163628 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111163628 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111163628 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111163628 (MTMR4)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     111163628 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     111163628 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     111163628 (MTMR4)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    111163628 (MTMR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 111163628
NCBI-ProteinID: XP_022408189
UniProt: A0A2Y9LEU0
Position
Unknown
AA seq 1211 aa AA seqDB search
MGQAEPGDLGLRPSPQGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFL
GRAADALIAISNYRLHIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFK
QCQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELAR
MGFDLQNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELQNVASFRSWKRVPVVVYRHLR
SGAAIARCSQPEVSWWGWRNADDEHLVTSIAKACALDAGTRATGGTASTGGSDAGEACDA
DFDSSLTACSGVESTAAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMAN
IHAIRNSFQYLRAVCSQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLV
HCSDGWDRTPQIVALAKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNE
QCPVFLQWLDSVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYK
RTCSVWALLRAGNKNFHNFLYTSGSEMVLHPVCHVRALHLWTAVYLPASSPCTLGEESMD
LYLSPVAQSQEFSGRSLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNRCQEARAGLE
PWHGNPEGSEATFVESGLGGVQQTVGEMALPPSLPGSQKDYLSNKPFKSHRSSSPSYRLL
NAAVPQEMKSSTSDPEFKVLEETKAPAPDPPAQDELGRTLDGTEEPPEHRPEKAAVRALS
KVVSNKRDGICDFPESSQDSLTGAPEQAQLDSVLGVPSRGAATHGLGILRNPLSAACQIP
PDPSTDCLNRDPPGSVASVSHQEQPGSVPDLIQGEEDMGKRGNNRNGQLLENPRFGKVPL
ELARKPISQSQISEFSFLGSNWDSFQGMVTSFPSGETTPRRLLSYGCCSKRSSSKQMRAT
GSCFGGQWTQREGVRSPVCSTHSNGHCTGPGGKNNQVWLSGHPKQVSGTKPVPLSCPSPV
PPLYLDDDGLPFPTDVIQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPM
DYEDDFTCLKESDGSDTEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCD
CEFWLAKRRHHCRNCGNVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQ
HLKKPIATASS
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgggccaggcggagcctggtgacttagggctgaggccttccccacagggtgaggagggg
ccccccagcctggagtacatccaagccaaggatctgttcccccccaaggaactagtgaaa
gaggaggagaatctgcaggtgcccttcacagtgctgcagggtgagggagtggagttcctg
ggccgtgcagccgatgccctcattgccatctccaactaccggctgcatatcaagttcaag
gattctgttatcaacgtccccctccggatgattgacagcgtggagagccgtgatatgttc
cagttgcacatcgcctgcaaggactccaaagtggtgaggtgccacttctccactttcaag
cagtgccaagagtggctctcgcggctaagtcgggccacggcgagacctgcgaagcctgag
gacctgtttgcctttgcctaccatgcctggtgcctggggctgactgaggaggaccagcac
acccacctgtgtcagccaggagagcacatacgatgtcggcaggaggccgagcttgcgagg
atgggctttgacctgcagaacgtctggagagtctcgcatatcaacagcaactacaaattg
tgccccagttacccccagaagctgctggttcccgtgtggatcacagataaagagctgcag
aacgtggcttccttccgctcctggaagcgggtccctgtggttgtgtataggcacctgcgc
agcggggctgccatcgcccgctgcagccagcccgaggtcagctggtggggctggcgcaac
gccgatgacgagcacttagtcacgtccattgctaaagcctgcgccctggacgcggggaca
agggccactgggggcactgccagcaccgggggtagtgatgccggcgaggcgtgtgacgct
gacttcgattcctccctgactgcatgctctggagtggagagcacagctgccccccagaag
ctgctgattctggacgcccgatcctacacggcagcggtggccaaccgggccaagggtgga
ggttgtgaatgtgaagagtactaccccaactgtgaggtcgtgttcatgggaatggccaac
atccatgccatccggaacagcttccagtacctccgtgctgtgtgtagccagatgcccgat
cccagcaactggttgtcggctctggagagcaccaaatggctgcagcacctgtcggtgatg
ctgaaggcagctgtgctcgtggctaatacagtagaccgggagggccggcctgtgctggtg
cactgctcggatggctgggatcggacgccgcagatcgtagccctggccaagatactactg
gacccgtattacaggacgttggagggtttccaagtgctagtagaatctgactggctggat
tttgggcacaagtttggagaccgctgcggccaccaggagaacgcagaggaccagaacgag
cagtgccctgtgttcctccagtggctcgattctgttcaccagttgctcaagcagtttccc
tgcctgtttgagtttaatgaagcgttcctggtaaagctggtgcagcacacgtactcctgt
ctctacggcacgttcctggccaacaacccctgtgagcgagagaagcgcaacatctacaag
cggacctgctctgtgtgggcccttttgcgagctggcaacaagaacttccacaacttcctc
tacacatcaggctcagaaatggtcctgcaccccgtgtgtcacgtccgggcgctgcacctc
tggacagctgtttacttgccagcgtcatctccatgcacactcggggaggagagcatggac
ctctacctttccccggtggctcagagccaggagttctctggccgctctctggacagatta
cctaaaacgagatctatggatgatcttctttctgcctgtgacacaagcagccccctgacg
cgcacatccagtgaccccaacctgaataaccgctgtcaggaggccagagcaggcctggag
ccctggcatggcaatcctgagggatcagaggcaaccttcgtggaatctgggctaggaggt
gttcagcagactgtaggagaaatggctcttcctccgtctctgcccggcagccagaaagac
tacttgagcaataaacctttcaagagtcacagaagctcttctccaagttacaggctgctt
aatgctgcagtgccccaggaaatgaagagcagcacctctgatcctgagttcaaagtccta
gaagagactaaggcaccagctccagaccctcctgcccaggatgagctgggtaggacttta
gatggcacagaggagccacctgaacatcgtcctgaaaaagcagctgtccgagcactctct
aaagttgtttccaacaagcgtgatggaatttgtgattttcctgagtcttcccaggactcc
ctcacaggtgcccccgagcaggcccagctagactctgtgctaggtgtgccctccagaggt
gctgcaactcacggtctgggcatccttcgcaacccgctgagtgctgcctgccaaattcct
ccagacccaagcaccgactgtctcaaccgagaccctccagggtctgtggcaagtgtctcc
caccaggaacagcccggttctgtgccagacctgattcagggggaagaagacatgggcaaa
agagggaataataggaatgggcagttattggaaaaccctcgctttggaaaggtgccattg
gaattggcccgaaagccaatttctcagagccagatcagtgagttctctttcttagggtcc
aactgggacagcttccaagggatggtgacttcattcccgagtggggagaccacccctcgg
cggctgctttcctatggctgttgtagcaagaggtcgagcagtaagcagatgcgggcaaca
gggtcttgcttcgggggacagtggactcagagagaaggggtgaggtcaccggtctgttct
actcattccaatggacactgtactggtccaggaggaaaaaacaaccaggtgtggttgtct
ggtcacccaaagcaggtctccggcacgaagcctgttcccctaagctgcccttctccagtg
cctcctctctacctggatgacgatggactcccctttcccacggatgtgatccagcataga
ttacggcagattgaagcggggtacaagcaagaggtggaacagctacgtcgacaggtgcgt
gagcttcagatgaggctggatatccgccactgctgcgcccctccagcagagccccccatg
gactacgaggatgattttacgtgtttgaaggagtcagatggcagtgatacggaagatttt
ggttctgatcacagtgaagactgcctttcagaagcaagctgggaacctgttgataagaaa
gagactgaggtgactcgctgggttccagaccatatggcatcacattgctataattgtgac
tgtgaattctggttggccaaacgcagacaccattgcagaaattgcgggaatgtattttgt
gctggctgctgccacctgaagttgcccattcctgatcaacaactctatgatccagttctc
gtctgtaactcatgttacgaacatatccaagtatctcgggccagagaactcatgagccaa
catctgaagaaacccattgctacagcttccagttga

DBGET integrated database retrieval system