KEGG   Delphinapterus leucas (beluga whale): 111164225
Entry
111164225         CDS       T05885                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00230  Purine metabolism
dle01100  Metabolic pathways
dle01522  Endocrine resistance
dle04015  Rap1 signaling pathway
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04072  Phospholipase D signaling pathway
dle04114  Oocyte meiosis
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04261  Adrenergic signaling in cardiomyocytes
dle04270  Vascular smooth muscle contraction
dle04371  Apelin signaling pathway
dle04540  Gap junction
dle04611  Platelet activation
dle04713  Circadian entrainment
dle04714  Thermogenesis
dle04723  Retrograde endocannabinoid signaling
dle04724  Glutamatergic synapse
dle04725  Cholinergic synapse
dle04727  GABAergic synapse
dle04742  Taste transduction
dle04750  Inflammatory mediator regulation of TRP channels
dle04911  Insulin secretion
dle04912  GnRH signaling pathway
dle04913  Ovarian steroidogenesis
dle04914  Progesterone-mediated oocyte maturation
dle04915  Estrogen signaling pathway
dle04916  Melanogenesis
dle04918  Thyroid hormone synthesis
dle04921  Oxytocin signaling pathway
dle04923  Regulation of lipolysis in adipocytes
dle04925  Aldosterone synthesis and secretion
dle04926  Relaxin signaling pathway
dle04927  Cortisol synthesis and secretion
dle04928  Parathyroid hormone synthesis, secretion and action
dle04934  Cushing syndrome
dle04935  Growth hormone synthesis, secretion and action
dle04970  Salivary secretion
dle04971  Gastric acid secretion
dle04972  Pancreatic secretion
dle04976  Bile secretion
dle05032  Morphine addiction
dle05163  Human cytomegalovirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111164225 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    111164225 (ADCY4)
   04371 Apelin signaling pathway
    111164225 (ADCY4)
   04020 Calcium signaling pathway
    111164225 (ADCY4)
   04072 Phospholipase D signaling pathway
    111164225 (ADCY4)
   04024 cAMP signaling pathway
    111164225 (ADCY4)
   04022 cGMP-PKG signaling pathway
    111164225 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111164225 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111164225 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111164225 (ADCY4)
   04062 Chemokine signaling pathway
    111164225 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    111164225 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    111164225 (ADCY4)
   04912 GnRH signaling pathway
    111164225 (ADCY4)
   04913 Ovarian steroidogenesis
    111164225 (ADCY4)
   04915 Estrogen signaling pathway
    111164225 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    111164225 (ADCY4)
   04921 Oxytocin signaling pathway
    111164225 (ADCY4)
   04926 Relaxin signaling pathway
    111164225 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    111164225 (ADCY4)
   04918 Thyroid hormone synthesis
    111164225 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    111164225 (ADCY4)
   04916 Melanogenesis
    111164225 (ADCY4)
   04925 Aldosterone synthesis and secretion
    111164225 (ADCY4)
   04927 Cortisol synthesis and secretion
    111164225 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111164225 (ADCY4)
   04270 Vascular smooth muscle contraction
    111164225 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    111164225 (ADCY4)
   04971 Gastric acid secretion
    111164225 (ADCY4)
   04972 Pancreatic secretion
    111164225 (ADCY4)
   04976 Bile secretion
    111164225 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    111164225 (ADCY4)
   04727 GABAergic synapse
    111164225 (ADCY4)
   04725 Cholinergic synapse
    111164225 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    111164225 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    111164225 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    111164225 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    111164225 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    111164225 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111164225 (ADCY4)
   04714 Thermogenesis
    111164225 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164225 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    111164225 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    111164225 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111164225 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111164225 (ADCY4)
   05163 Human cytomegalovirus infection
    111164225 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    111164225 (ADCY4)
Enzymes [BR:dle01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111164225 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N RHIM CD52 DUF3040
Other DBs
NCBI-GeneID: 111164225
NCBI-ProteinID: XP_022409363
UniProt: A0A2Y9LIN8
Position
Unknown
AA seq 1237 aa
MPSQLPILAETLPVRNQKPSPTSAWTPGPGPQGYQGAEIRDTNWPPRAPGPNPVPAAVWE
WTATAPQSYTQMCPSPGAGHHWSMDHSDTATPLPSRLEEQGMTASHPNLEPSPRMAPCSS
SLHPCQPSLQPALSLPTSKPQGSPQGGIALGRGDHGPPLQSPAASQRRPLLRDLLQPEPA
VPTAATAAGDRARRAPGAARCCLGQRQVQEEELASDPGFLTTMLCGLGGFSLLLGLASRE
QRLQRWTRPLSGLVWAALLALGLGFLFTGGVVSAWDQVPFFLFVIFTVYAMLPLGMRDAA
AAGLASSLSHLLVLGLYLGPQPNSQPALLPQLAANAVLFLCGNVAGAYHKALMERALRAT
FREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFH
SLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGD
CYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQ
KWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAGAYAVEDAAMEHGDPYLRELGEP
TYLVIDPRAEEDEKGTAGGLLSSLEGPKMRPSLLMTRYLESWGAAKPFAHLSHVESPVST
STPLPEKALSSFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSEDFNPL
TLYFREKEMEKEYRLSALPAFKYYAACTFLVFFSNFIIQMLVTNRPPALTITYSITFLLF
FLLLFVCFSEHLTKCVLKGPKMLHWLPTLSVLVATRPGLRVALGTATILLVFSMAITSLV
FLPAASNCPFRAPNVSFTASNLSWELPGSLPLISVPYSVHCCVLGFLSCSLFLHMSFELK
LLMLLLWLAACCSLFLHSHAWLSDCLIARLYLGALDSSLLRPGVLKEPKLMGAISFFIFF
FTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRR
NEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLRLLNEIIADFDELLSKPKFSG
VEKIKTICSTYMAATGLNATSGQDAQQDAEQSCSHLGTMVEFAVALGSKLDVINKHSFNN
FRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETACALQSLG
YTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3714 nt   +upstreamnt  +downstreamnt
atgcccagccagctccccatccttgcagagaccttacctgtcagaaaccagaagcccagc
cccacctcggcttggaccccaggtcctggaccccaagggtatcagggggctgagatacgt
gacaccaactggcctcccagggcaccagggccaaatccagtaccagctgctgtctgggag
tggacagcgacggctccacaaagctacacgcagatgtgcccctcccctggagctggacac
cactggagtatggaccactcagatacggccacaccgctgccatctaggctggaggagcag
ggaatgaccgcctcccatcctaacctagaacctagcccccgtatggcaccatgttcttct
tccctgcatccttgccagccttcgctccagcccgccctcagtctccccacatccaagccc
caggggtcaccccaaggcggtatagctctgggcaggggagaccatggcccgcctcttcag
tccccggccgcctcccagcgaagacctcttctacgagacctactacagcctgagccagca
gtacccactgctgctactgctgctggtgatcgtgctcgtcgggctcctggtgctgctcgc
tgttgcctgggccagcggcaggtccaggaagaggagctggcctcagacccgggcttcctg
accactatgctgtgcgggctgggcggcttctcgctgctgctgggcctggcttcccgcgag
cagcgactgcagcgctggacgcgtcccctgtcgggcctcgtgtgggcagcgctgctcgcg
ctaggcctcggcttcctcttcaccgggggcgtggtgagcgcctgggaccaggtgcccttt
ttcctttttgtcatcttcaccgtgtatgccatgttgcccttgggcatgcgggacgccgcc
gccgcgggcctcgcctcttcactctcacacctgctggtcctcgggctgtatcttgggcct
cagccgaactcacagcccgcgctgctgccgcagctggcggcaaacgcggtgttgttcctg
tgcgggaacgtggccggagcataccacaaggcgctgatggagcgcgcgctgcgtgccacg
ttccgggaggcgcttagttccctgcactcccgccggagactcgacaccgagaagaagcac
caggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaaggcggag
atcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaacttccac
agcctctatgtcaagaggcaccagggagtgagcgtgctgtatgctgacatcgtgggcttc
acgcggctggccagtgagtgctcccctaaggagttggtgctcatgctaaacgagctcttt
ggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctgggagac
tgttactactgtgtctccgggctgccgctctcgctgccagaccacgccatcaactgcgtg
cgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccaccggcgtggat
atcaacatgcgcgtgggcgtgcactcgggcagcgtgctctgcggggtcatcgggctgcag
aagtggcagtatgatgtctggtcccatgacgtcactctggccaaccacatggaggcgagt
ggagtgccaggacgagtacatatcacaggggctacgctggcactgctggcaggggcttat
gctgtggaggatgcagccatggaacacggggacccataccttcgggagctaggggagccg
acctaccttgtcatcgatccccgggctgaggaggacgagaagggcactgcaggcgggttg
ctgtcctctcttgagggccccaagatgcgtccatcactgctgatgacccgctacctggag
tcctggggtgcagccaagcctttcgcccacctgagccatgtggagagccctgtgtccacc
tccacccctctcccggagaaggccctgtcttccttcagcccccagtggagccttgaccgg
agccgtactccccggggactagatgatgaactagacaccggggatgccaagttcttccaa
gtcatcgaacagctcaactctcagaaacagtggaaacaatcagaggacttcaacccattg
acactctacttccgagagaaggagatggagaaagagtatcggctctctgcactccccgcc
ttcaaatactatgcagcctgcaccttcctggtctttttctccaacttcatcatccagatg
ctggtgacaaacaggcccccagctctgaccatcacctatagcatcaccttcctcctcttc
ttcctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtcttgaaaggcccc
aagatgctgcactggctgcccacactgtctgtcctagtggccacacggcccggactgcga
gttgccctgggcaccgctaccatcctgctcgtcttctccatggccattaccagcctggtc
ttcttaccggcagcatcaaactgccctttccgggctcccaatgtgtccttcacggcttcc
aacctctcctgggagctccctgggtccctgcctctcatcagcgtcccctactccgtgcac
tgctgcgtgctggggttcctctcctgctccctcttcctgcacatgagcttcgagctgaag
ctgctgatgctgctgctgtggctggcagcctgctgctccctctttctgcactcccacgcc
tggctgtccgactgtctcatcgcccgcctctatctgggtgccttggactccagcctcctc
aggccaggggtgctgaaggagcctaaattgatgggagcaatctccttcttcatcttcttc
ttcaccctcctggtcctggctcggcagaatgagtattactgccgcctggacttcctgtgg
aagaagaagctgaggcaagagcaggaggagacagagacgatggaaaacctgactcggctg
ctcttggagaatgtgctccccgcgcacgtagccccccagttcatcggccagaatcggcgc
aacgaggacctctaccaccagtcctacgagtgtgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttttactctgaatccagcatcaaccatgaggggctagagtgtctgcgg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaaaatcaaaacgatctgcagcacctacatggcagctacaggcttgaacgccacc
tctggacaggacgcacagcaggatgctgagcaaagctgcagccaccttggcaccatggta
gagtttgctgtggcccttgggtctaagctggacgtcatcaacaagcactcattcaacaac
ttccgcttgcgtgtggggttaaaccacggacctgtagtggccggagtgattggggcccag
aaaccacaatatgacatctggggcaacacggtgaacgtggccagccgaatggagagtaca
ggcgtcctgggcaagatccaagtgaccgaagagacagcctgcgccctgcagtccttaggc
tacacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcctgaacacagatttgacacgaactggacctccctcggccaccctaggctga

DBGET integrated database retrieval system