KEGG   Delphinapterus leucas (beluga whale): 111164230Help
Entry
111164230         CDS       T05885                                 

Gene name
LTB4R
Definition
(RefSeq) LOW QUALITY PROTEIN: leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111164230 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dle04030]
    111164230 (LTB4R)
G protein-coupled receptors [BR:dle04030]
 Rhodopsin family
  Lipid
   Leukotriene
    111164230 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 111164230
NCBI-ProteinID: XP_022409383
UniProt: A0A2Y9LVS8
Position
Unknown
AA seq 351 aa AA seqDB search
MATNTTSPEASSSPGVMFISLLVIIVLSVALAVGLPSNSFVVWSILVEMRKRSVTALLVL
HLALADLAVLLTAPFFLYYTAQGTWTFGLAGCRLFHYVCGVSMYASNLLITAMSLDRSLV
VALPSVSQKXRTKTVAWRALAGIWVVSVLLATPVILYRRVTLGPDNRSLVCFPKYPSEAH
XAFHLFFEVVTGFLLPFLAVVASYSDIRRRLRIRRFRRSLCTGRLLAFAAFWLPYHVVNL
AEGVRALAGKTLGSRPESQRLHLTRXALRTLAFLSSSVNPVLYACAAGGLQRSAGTAFVA
KLLEGTGSEASSSRRGGTLAQTVRGAPASPEPGPAESLTASTNPLERSEVS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaacactacatctcctgaagcatcctcgtcaccaggtgtcatgttcatctct
ctgctggttatcatcgtactgtcagtagcactggctgtggggctgcccagcaacagcttt
gtggtgtggagcatcctggtagagatgcggaagcgctctgtcactgccctgctggtgcta
cacttagccctggccgacttggccgtattgctcactgccccctttttcctctactacacg
gcccaaggcacctggacttttggactggctggctgccgcctgtttcactatgtctgcgga
gtcagcatgtatgccagcaacctgcttatcacggccatgagcctggaccgctcgctggtg
gtggccctcccctctgtgtcccagaaanctcgcaccaagacagttgcctggcgggcgcta
gcaggcatctgggtggtgtctgtcctgctggccacacccgtcatcttgtaccgcagagtg
acgttgggtccggacaacaggagcctggtctgcttcccgaagtaccccagcgaagcacat
ngggctttccatctgttcttcgaggtggtcaccggcttcctactgcccttcctggccgtg
gtggccagctactccgacatccggcgccggctgcggatccggcgcttccgccgcagcctc
tgcaccggccgcctgctggccttcgctgccttctggctgccctaccacgtggtgaacctg
gccgagggggtccgagcgctggcgggcaagacattggggtcccggcctgagagtcagcgg
ctgcacctgacccgcnaagcgctcagaacgctggccttcctgagcagcagcgtgaacccc
gtgctgtacgcatgcgctgccggtggcctgcagcgctcggctggcacggccttcgtcgcc
aagctgttggagggcaccggctccgaggcgtccagcagccgccgcgggggcaccctggcc
cagacggtgaggggtgcccccgcctctcccgaacctggccccgccgagagcctcactgcc
tccaccaaccctctcgagcgaagcgaagtcagctag

DBGET integrated database retrieval system