KEGG   Delphinapterus leucas (beluga whale): 111167849Help
Entry
111167849         CDS       T05885                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable glutamate--tRNA ligase, mitochondrial
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00860  Porphyrin and chlorophyll metabolism
dle00970  Aminoacyl-tRNA biosynthesis
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    111167849
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111167849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dle01007]
    111167849
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dle03016]
    111167849
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:dle02048]
    111167849
Enzymes [BR:dle01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     111167849
Amino acid related enzymes [BR:dle01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   111167849
Transfer RNA biogenesis [BR:dle03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111167849
 Prokaryotic type
   Other AARSs
    111167849
Prokaryotic defense system [BR:dle02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    111167849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 111167849
NCBI-ProteinID: XP_022416856
UniProt: A0A2Y9M713
Position
Unknown
AA seq 532 aa AA seqDB search
MAVLLKRLLHPRRPPVALGHPLGRGEASLGTDPRAAVRVWFAPSPTSFLHLGGLHTALYN
YVFAKKHLRLEDMDQTRLVLGTAENIEDMLEWAGVPPDKSPRRGGPAGPYLESQRLALYT
HATEALLKREALRNHQTRQYDNQCRSLSQAQVAQKLAKDPKHATHFRPEXETPAFQDLVY
GWNPHKVASMEGDPVILKSDGFPTYHLACVVIDHHMGIRRLLRGSEWLVSTSKHLLLHQA
LGWQPPRFAHLPLLLNRDGSKLSKRHGDICCRRLPADALLDIITNCGSGFAENQMGRTLP
EPITQFNLTRITCHSALLDPEKLPEFNRLHLHQLVSDETQRRQLVGKLQALAEEAFGSQL
QDRRVLDAAYAERIILLRQGHICRLQDSVSPAHSYLWTRPAVGRAQLGAISERVDVIAKH
VPGLLEGSGGNLTQDMLNGELKKLPESLEGTKHSNAMKLQRKCGNEYRRCFPDGEKVCGT
AEVAVGTVVAGPALRQGQQGTWTPSEARGRNQEWAQSLRVHRCIYGATPGMP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctcctgaagaggttgctgcatccccggaggcccccagtggccttgggccac
cccctgggacggggtgaggccagcctgggcaccgatcccagggctgctgtgcgagtgtgg
ttcgcccccagccccacaagcttcttgcacctgggcggcctccacactgccttgtacaac
tacgtctttgccaagaagcacctgaggctggaggacatggatcagacccgccttgtgctt
gggacagcagagaatattgaggacatgctggagtgggcaggcgtcccccctgacaagagc
ccccgccggggaggtcctgcagggccctacctggaatctcagcgacttgcgctctacacg
catgctaccgaagctctgctgaagagggaggccctgaggaaccatcagactcgccagtat
gacaatcagtgccggagcctgagccaggcgcaggtggcccagaagctggccaaagacccc
aagcatgccacccacttccgcccggagngggagacaccagccttccaggacttggtgtat
ggctggaatccgcacaaggtggccagcatggagggggacccggtcatcctgaagagtgat
ggcttccccacgtaccacctggcctgcgtggtgatcgaccaccacatgggcatcagacgc
ttgctgcggggctccgagtggctggtctccacctctaagcacctgctcctccaccaggcc
ctgggctggcagcccccgcgctttgcccacctgcccctgcttctcaacagggatggcagc
aagctgtccaagagacacggggacatttgctgccggcggcttcctgccgatgccctgctt
gacatcatcaccaactgcggctcagggtttgcagagaaccagatggggaggaccttgcca
gagccgatcacacagtttaacctgacccggatcacctgccactcagccctgctggacccg
gaaaagctcccagagttcaacaggctgcacctccaccagctggtgagcgatgagacccag
agacgccagctggtggggaagctgcaggccctcgcggaagaggctttcgggagccagctg
caagacaggcgtgtgctggacgcagcctacgcggagaggatcatcctgctgagacagggg
cacatttgccgcctgcaggattcggtctccccagcgcactcctacctgtggactcgccct
gctgtgggtcgagcgcagctgggtgccatctcagagagggtggacgtcattgccaaacac
gtgccggggcttttagaaggatccggtgggaacttaactcaggacatgctgaacggagaa
ctgaagaagctgccagaaagtctggaaggcaccaaacacagtaacgcgatgaagctccaa
aggaagtgcgggaacgaatacagaaggtgctttccagatggagagaaggtgtgcgggaca
gcggaggtggccgtgggaaccgtagttgcgggacctgccctcagacaggggcagcagggg
acctggaccccgtcggaagctcgtggaaggaaccaagagtgggcacagagcctccgggtg
cacaggtgcatttacggcgccacgccaggcatgccctaa

DBGET integrated database retrieval system