KEGG   Delphinapterus leucas (beluga whale): 111167911
Entry
111167911         CDS       T05885                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111167911 (ANKRD53)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    111167911 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 111167911
NCBI-ProteinID: XP_030619057
Position
Unknown
AA seq 467 aa
MRLAEKVSARCGDSAARRPSSVSLAEVWDQRAIGSYHELFAASLGNLEWLRFCLNRHRGK
IPADDKGFTAIHFAAQSGKLACLRVLVEEYKFPADLPTNNGQTPLHLVIHSDNKTVALPC
IHYLIKQGAALNTQTCNGSTPLHLAAREGLLSCVKVLVQKGANVHAQDAMGCKPIDYCKI
WNHRICARFLKDAMWKQDKKDFAHEMGKLKRLKNQLAIMEEDYLTEYQKEHQILREADFK
KWLHRKLLPQGQSLIRNTQGEPRPPPQATVLSKTPKHGALWPPKSFYPSQEACLRQTLQP
SQPSVMPIPTCKQLMVRRPKVWNLSNNPVRSPTAQIGYPQGIRLGVHPDPRPEHDFRCFL
EVRSDGHGGALLRTVAGNQVAPVPRLPLEVIIRELYPSLQPCRMKVPQGFCSVTMREVPR
KRRLGDGTFWTDTLSMNLRETFDEGFLAAVRAHQGLPTLPSPKPPPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgcggctggcggagaaggtgtcagctaggtgcggcgactcggcggcccggcggcccagc
tccgtgagtctcgccgaggtgtgggaccagagggcgatcgggagctaccacgagctgttc
gcggcctcgttgggcaacctggaatggttgcggttctgtctaaatcggcaccgggggaaa
atcccggccgatgacaagggtttcactgccatccactttgcagcccagagcggcaagctt
gcatgcctgcgggtcttggtagaggagtacaagtttcccgcggacctgcccaccaacaat
ggccagacacctctacaccttgtcatccacagtgacaacaagaccgtggccctgccctgc
attcactatctgattaagcaaggggcggccctcaacactcagacatgcaacggctccaca
cccctgcacctggcagcccgcgagggcctgctgagctgtgtgaaggtcctggtgcagaaa
ggtgccaatgttcatgcccaagatgccatgggctgcaagcccatcgactactgcaaaata
tggaaccaccgcatctgtgcccggttcttgaaggatgccatgtggaaacaggacaagaag
gactttgcccatgagatggggaaactgaagaggctcaagaaccagctggccatcatggag
gaggactacctgactgagtatcaaaaagagcaccaaattctgagagaagctgacttcaag
aagtggctccatcgcaagctgctgccccaaggccaatccctgatccgcaacactcaggga
gagccccgtcctccaccccaggccactgtgctctccaagacccccaagcacggggcactg
tggcctcccaagagcttctacccctcccaagaggcgtgcctgcgacagacactgcagccc
agtcagccctcggtgatgcctatacccacctgcaagcagctcatggtcaggcggcccaag
gtgtggaatctcagcaacaaccctgtcaggtcccccaccgcccagatcggctacccgcag
ggcatccgcctgggcgtgcatcccgaccccaggccggagcacgacttccgctgcttcctc
gaggtgaggtccgacgggcacggcggtgcgctcctgcgcacggtggccggcaaccaggtg
gcgcctgtgccccggctgcctttagaggtgataatccgtgagctgtacccgtcgctgcag
ccgtgcaggatgaaggtaccccagggcttctgttctgtcaccatgagagaggtgccccgg
aagcggcgcctgggtgatggcaccttctggaccgacactctgagcatgaacctgcgagag
acatttgacgaaggcttcctggcagctgtgcgagcccatcaagggctccccactctgccc
tcccccaaaccaccccccacttaa

DBGET integrated database retrieval system