KEGG   Delphinapterus leucas (beluga whale): 111168030
Entry
111168030         CDS       T05885                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04080  Neuroactive ligand-receptor interaction
dle04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111168030 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111168030 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 111168030
NCBI-ProteinID: XP_022417240
UniProt: A0A2Y9M6A9
Position
Unknown
AA seq 77 aa
MNLRLCVQALLLLWLSLSAVCGGPLLQTSDGKGMEEGTIRHLVQPRGPRSGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgagcgcggtg
tgtggagggcccctgctgcagacttctgacgggaaggggatggaggaaggcaccatccgc
cacctggtgcagcccagagggccgaggagcggcccagggccctggcagggaggtcggagg
aagttccgccgccagcggccgcgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system