KEGG   Delphinapterus leucas (beluga whale): 111170265Help
Entry
111170265         CDS       T05885                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01524  Platinum drug resistance
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04217  Necroptosis
dle04650  Natural killer cell mediated cytotoxicity
dle04722  Neurotrophin signaling pathway
dle04932  Non-alcoholic fatty liver disease (NAFLD)
dle04940  Type I diabetes mellitus
dle05142  Chagas disease (American trypanosomiasis)
dle05143  African trypanosomiasis
dle05160  Hepatitis C
dle05161  Hepatitis B
dle05162  Measles
dle05163  Human cytomegalovirus infection
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05168  Herpes simplex virus 1 infection
dle05170  Human immunodeficiency virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05320  Autoimmune thyroid disease
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111170265 (FASLG)
   04010 MAPK signaling pathway
    111170265 (FASLG)
   04068 FoxO signaling pathway
    111170265 (FASLG)
   04151 PI3K-Akt signaling pathway
    111170265 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111170265 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111170265 (FASLG)
   04217 Necroptosis
    111170265 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111170265 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111170265 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111170265 (FASLG)
   05205 Proteoglycans in cancer
    111170265 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111170265 (FASLG)
   05330 Allograft rejection
    111170265 (FASLG)
   05332 Graft-versus-host disease
    111170265 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111170265 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    111170265 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111170265 (FASLG)
   05162 Measles
    111170265 (FASLG)
   05164 Influenza A
    111170265 (FASLG)
   05161 Hepatitis B
    111170265 (FASLG)
   05160 Hepatitis C
    111170265 (FASLG)
   05168 Herpes simplex virus 1 infection
    111170265 (FASLG)
   05163 Human cytomegalovirus infection
    111170265 (FASLG)
   05165 Human papillomavirus infection
    111170265 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    111170265 (FASLG)
   05143 African trypanosomiasis
    111170265 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111170265 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111170265 (FASLG)
   04052 Cytokines and growth factors [BR:dle04052]
    111170265 (FASLG)
   04090 CD molecules [BR:dle04090]
    111170265 (FASLG)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111170265 (FASLG)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Tumor necrosis fators
   111170265 (FASLG)
CD molecules [BR:dle04090]
 Proteins
  111170265 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 111170265
NCBI-ProteinID: XP_022420944
UniProt: A0A2Y9MFA3
Position
Unknown
AA seq 262 aa AA seqDB search
MQQPLNYPYPQIFWVDSSASSPWASPGSVFPCPSSVPGRPGQRRPPPLPPPLKKRRGHNT
GLCLLVMFFMVLVALVGLGLGLFQLFHLQKELAELRESTSQRHTESSLEKQIGHPNPSSE
KTELRKAAHLTGKPNSRSIPLEWEDTYGIALVSGVKYKKGSLVINETGLYFVYSKVYFRG
QSCNNQPLNHKVYTRNFRYPQDLVLMEGKMMDYCTTGQMWARSSYLGAVFNLTNADHLYV
NVSEPSLVNFEESKTFFGLYKL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccgtacccccagattttctgggtggacagcagtgccagc
tctccctgggcttctccagggtcagtcttcccctgtccgtcctctgtgccaggaaggccc
gggcaaaggaggccaccgccactaccaccacctctgaagaagaggaggggccacaacaca
ggcctgtgtctccttgtgatgtttttcatggttctggtggccctggttggattgggactg
ggactatttcagctcttccacctgcagaaggaactggccgagctcagagagtccaccagc
caaaggcatacagaatcgtctttggagaagcaaataggtcaccccaatccatcctctgag
aaaacggagctgagaaaggcagctcatttaacaggcaagcccaactcaagatccatccct
ctggaatgggaagacacttatggaattgccctggtctctggggtgaagtataagaagggc
agccttgtgatcaatgaaactgggctgtattttgtgtattccaaagtgtacttccggggt
cagtcctgcaacaaccagcccctgaaccacaaggtttacacgaggaattttaggtacccc
caggacctggtgctcatggaggggaagatgatggactactgcactactggccagatgtgg
gcccgcagcagctacctgggggctgtgttcaatctcaccaatgctgaccatttatatgtc
aatgtatctgagccctctctggtcaattttgaggaatctaagacattttttggcttatat
aagctctaa

DBGET integrated database retrieval system