KEGG   Delphinapterus leucas (beluga whale): 111170313Help
Entry
111170313         CDS       T05885                                 

Gene name
APBB2
Definition
(RefSeq) amyloid-beta A4 precursor protein-binding family B member 2 isoform X1
  KO
K04530  amyloid beta A4 precursor protein-binding family B member 2
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    111170313 (APBB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID WW PTB
Motif
Other DBs
NCBI-GeneID: 111170313
NCBI-ProteinID: XP_022421072
UniProt: A0A2Y9MFQ2
Position
Unknown
AA seq 768 aa AA seqDB search
MGRRYPEAHCYPGSSSDSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNA
EIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAA
EQGQQDPNRNVSPTAVINITSEKLEGKEPHPRDSSGCEILPSQPRRTKSFLNYYADLETS
TRELEQNLGNQHGAVEEKAQPSQSQASTVAGNGDLLLQKPNRPQFSPEDGQIATVSSSPE
TKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSADETADIWSDHSFQTDP
DLPPGWKRISDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQP
WSDFAVLNGGKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHADDDDSCSI
NSDPEAKCFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDM
YLVLENDTLSLVDPMDHSALHTQPIASIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRC
DTPAKAIATSLHEICSKIMAERKNAKALACSSLQERAHVNLDVPLQVDFPTPKTELVQEF
HVQYLGMLPVDKPVGMDTLNNAIESLMTSSSKEDWPSVNMNVADATVTVISEKNEEEILV
ECRVRFLSFMGVGKDVHTFAFIMDTGNQHFECHVFWCEPNAGNVSEAVQAACMLRYQKCL
VARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEAP
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgggcagacggtacccagaggctcactgttatccaggcagctcatctgactcaggtgta
gacactttggcagtgtttatggccagcagcggaacgacagacgtcacgaatcggaatagc
ccagccacaccaccaaacacccttaatctccgttcctcccacaatgaattgttgaacgct
gaaatcaaacacacagaaaccaagaacagcacaccccccaaatgcaggaaaaaatatgca
ctaactaacatccaggcggcgatgggcctctcggatccggccgcacagcccctcctggga
aatggctctgccaacatcaagctggtgaaaaatggagagaaccagctccggaaggctgcg
gaacaagggcagcaggaccccaacagaaacgtcagccccactgcagtcatcaacataact
tctgagaagttagagggtaaagagccccacccacgggattcctcgggctgcgagatttta
ccctcccagccccgaagaaccaagagcttcctgaattactatgcagacctggaaacctca
accagagaactcgagcagaatttgggaaaccagcatggggctgtggaagagaaggcccag
ccaagccagagccaggcctccaccgtcgctgggaatggcgacttactgctgcagaaacca
aacagaccccagttcagccctgaagatggccagatagccaccgtatcatccagcccggag
accaagaaggatcaccctaaaacgggggccaaaactgactgtgcactccaccggatccag
aacctggcaccgagcgacgaggagtccagctggacgaccctgtcccaagacagtgcctcc
cccagctccgcagatgagacagcagatatatggagtgatcactcctttcagactgatcca
gatttgccacctggctggaaaagaatcagtgacatcgctgggacctattattggcacata
ccaaccgggacgactcagtgggaacgccctgtctccatcccagcagatctccagggttct
aggaaagggtcccttagttctgtaacgccatctcccaccccagagaacgagaaacagcca
tggagtgattttgctgttctgaatgggggaaagattaatagtgacatttggaaggatttg
catgcagccacagtcaacccggaccccagtttaaaagagtttgaaggagccacactgcgc
tatgcatccttgaaactcagaaatgccccacatgctgacgatgatgattcttgtagtatc
aacagtgacccagaagctaagtgttttgctgtacgctctctggggtgggtggaaatggca
gaggaggacctcgcccctggcaagagtagtgttgccgtcaacaactgcatcaggcagctt
tcttactgcaaaaatgacatccgtgatacagtcggcatttggggagaggggaaggacatg
tacctggtcctggagaacgacacgctgagcctggtggaccccatggaccacagcgcgctc
cacacgcagcccatcgccagcatccgcgtgtggggcgtgggccgcgacaacggccgagat
tttgcttatgtagcaagagacaaagacacaagaattttgaaatgtcatgtatttcgatgt
gacacaccagcaaaagccattgccacaagtctccacgaaatctgttccaagatcatggcc
gaacggaagaacgccaaagccctggcctgcagctccctgcaggaaagggcccacgtgaac
ctcgacgtgcccctgcaagtagattttccaacaccaaagactgagctggtccaggagttc
cacgtgcagtacttgggcatgctacctgtggacaaaccagtcggaatggataccctgaac
aatgccatagaaagtcttatgacctcgtccagcaaggaggactggccttcggtgaacatg
aatgtggccgatgctactgtgactgtcatcagtgagaagaatgaagaggagatcctggtg
gagtgtcgggtgcgattcctgtccttcatgggcgtcgggaaggatgtgcatacgtttgcc
ttcatcatggacactgggaaccagcactttgagtgccatgttttctggtgcgagcctaat
gccggtaacgtgtccgaggcagtgcaggctgcctgcatgttacgataccagaagtgcctg
gtagccaggccgccttcacagaaagttcgaccacctcctccgccagcagactctgtgacc
aggagagtcacaaccaatgtaaaacgaggggtcttatccctcattgacactttgaaacag
aaacgccctgtcacagaagcgccgtag

DBGET integrated database retrieval system