KEGG   Delphinapterus leucas (beluga whale): 111171736Help
Entry
111171736         CDS       T05885                                 

Gene name
CDK15
Definition
(RefSeq) cyclin-dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111171736 (CDK15)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111171736 (CDK15)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111171736 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 111171736
NCBI-ProteinID: XP_022423137
UniProt: A0A2Y9MVS1
Position
Unknown
AA seq 353 aa AA seqDB search
MGQELCAKTLQPGCSCHCCWEGGDAHSRQRSAPVMMEAAIKLTDLKEASCSMTSFHPRGL
QAVHARKFKSKRPRSNSDSFQEEDLSRGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKV
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDNWPGVSKLPNYNPEWFPLPKPQSLQNVCNR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagagctgtgtgcaaagactctgcagcctggatgcagctgccattgctgttgg
gagggaggagatgcacacagccgtcagaggagtgctccggtgatgatggaggctgcgatc
aagctaacagacctaaaagaagcatcatgttccatgacttcatttcaccccaggggactt
caggctgtccatgcccggaagttcaagagtaaaaggccacggagtaacagcgattctttt
caggaagaggatctgagtcgggggtttcagtggaggaagagcctcccctttggggcagcc
tcatcttacttgaacttggagaagctgggtgaaggttcttacgctacagtttacaagggg
attagccggataaatggacaactagtggctttaaaagtcatcagcatgaatgcagaggaa
ggagtcccatttacagccatccgggaagcttctctcctgaagggtttgaaacatgccaat
attgtgctgctccatgacattatccacaccaaagagacactgacattcgtttttgaatac
atgcacacagacctggctcagtatatgtctcagcatccaggagggcttcatcctcacaat
gtcaggcttttcatgtttcaacttttgcggggcctggcgtacatccaccaccaacacgtc
ctccacagggacctgaaacctcagaacttactcatcagtcacctgggagaactcaaagtg
gctgattttggtcttgctcgggccaagtccattcccagccagacatactcttcagaagtt
gtgactctctggtaccgccctcctgatgccttgctgggagccactgaatattcctctgaa
ctggacatatggggtgcaggctgcatctttattgaaatgttccagggtcaacccttgttt
cctggggtttccaacatccttgaacagctggagaagatctgggaggtgctgggagtccct
acagaggataactggcctggagtttccaagctacctaactacaatccagaatggttccca
ctgcctaagcctcagagccttcagaatgtctgcaaccggtaa

DBGET integrated database retrieval system