KEGG   Delphinapterus leucas (beluga whale): 111171948Help
Entry
111171948         CDS       T05885                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04136  Autophagy - other
dle04140  Autophagy - animal
dle04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111171948 (ATG16L1)
   04136 Autophagy - other
    111171948 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111171948 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111171948 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111171948 (ATG16L1)
Membrane trafficking [BR:dle04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    111171948 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    111171948 (ATG16L1)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111171948 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A V_ATPase_I Fez1
Motif
Other DBs
NCBI-GeneID: 111171948
NCBI-ProteinID: XP_022423700
UniProt: A0A2Y9MP10
Position
Unknown
AA seq 607 aa AA seqDB search
MSSGLRASVFPRWKRHISEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAHKLQAEK
HDIPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DKEMQMNEAKIAECLQTISDLETECLELRTKLQDLERANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPAEQDDDI
EVLVDETSDHAEEASPVRAVSRAAAKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
HPGSSKEVRVPTTAMCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGDKCEFKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSES
IVREMELLGKITALDLNPERTELLSCSRDDLLKIIDLRINAVRQTFSAPGFKCGSDWTRV
VFSPDGSYVAAGSAEGSLYIWSVLSGKVEKVLSKHHSSAINAVAWSPAGSHVVSVDKGSK
AVLWSEY
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgcctccgtcttcccccgctggaagcgccacatctcggaggaa
ttgaggcgccgggaccggctgcagaggcaggcgttcgaagagatcatcctgcagtataac
aagttgctggaaaagtcagatcttcattcagtgctggcccataagctacaagctgaaaag
catgacataccaaacaggcatgagataagtcctggacatgatggtgcatggaatgatagt
cagctgcaagaaatggcccagctgaggattaaacaccaagaagaactgactgaattacac
aagaaacgtggggagttagctcagttggtgattgacctgaataaccaaatgcagcagaag
gacaaggagatgcagatgaatgaagccaaaattgcagaatgcttgcagaccatctctgat
ctcgagaccgagtgcctggaactacgcactaagcttcaggaccttgaaagagccaaccag
accctgaaggatgaatatgatgccctgcagatcactttcactgccctggaggagaaactg
aggaagactactgaggagaaccaggagctggtcaccagatggatggctgagaaagcccag
gaagctaatcgcttaaatgcggagaatgagaaggattcgaggaggcggcaagcccggctg
cagaaggagctcgcagaagcagcaaaggaacctctcccagctgagcaggatgatgacatt
gaagtccttgtggatgaaacctccgatcacgctgaggaggcctctccggtgcgggccgtc
agcagagcagccgctaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttgggaggcgctctgtgtcttcctttccagttccccaggataacgtggatact
catcctggctctagtaaagaagtgagggtgccaacgaccgcaatgtgtgtcttcgatgct
cacgatggggaggtcaatgctgtgcagttcagtccgggttcccggctcctggccacggga
ggcatggatcggagggtgaagctctgggaagtgttcggagacaaatgtgagttcaagggc
tccctgtccggcagtaatgcaggaattacaagcattgaattcgatagtgctggatcttac
ctcttagcagcgtcaaatgattttgcaagccgcatctggactgtggatgactatcggcta
cggcatacactcacgggacacagcggcaaagtgctgtctgccaagttcctgctggacaat
gcgcgtattgtttctggaagtcacgaccggaccctcaaactctgggatctacgcagcaaa
gtctgcataaagacggtatttgccggatccagctgcaatgatattgtctgcacagagcag
tgtgtgatgagtggacattttgacaagaaaattcgtttctgggacatccgatcagagagt
atcgtccgagagatggagctcttgggaaagattactgccctggacttaaacccagaaaga
actgaactcctcagctgctcccgagatgacctgctaaaaattattgacctacgaataaat
gccgtcagacagacattcagcgcgccgggcttcaagtgcggctccgactggacgagagtt
gtgttcagccctgacggcagttacgtggcagcaggctcagccgagggctctctctacatc
tggagcgtgctctccgggaaagtggagaaggtcctttcaaagcatcacagctcagcgatc
aacgccgtggcctggtcgcctgccggctcccatgtcgtcagcgtggacaaaggaagcaaa
gctgtgctgtggtcagagtactga

DBGET integrated database retrieval system