KEGG   Delphinapterus leucas (beluga whale): 111172535Help
Entry
111172535         CDS       T05885                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00010  Glycolysis / Gluconeogenesis
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111172535 (MINPP1)
   00562 Inositol phosphate metabolism
    111172535 (MINPP1)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111172535 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111172535 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 111172535
NCBI-ProteinID: XP_022425138
UniProt: A0A2Y9N7C4
Position
Unknown
AA seq 486 aa AA seqDB search
MLRGPCRLFRVSVAPVAALAVALVSSLSRCSLLEPEDRVVSPLSPYFGTKTRYEDANPGL
LPDPEAPRRDPQLLEETCIPVQLVALIRHGTRYPTTKQIRKLRQLHGLLQARGPGDDRIR
AAGGGDLGAVLANWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPVLFSRENCGRLQLV
TSSKHRCVDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVE
RNATALYHVEAFKTGPEMQNILKKVAGILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSQSSCTLFQDIFQHLDKAVEQKQSSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQTHRKFRSGHIVPYASNLIFVLY
HCKNAKTPKEEFQVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKV
NTSDEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtggcccttgccgtctcttcagggtctccgtggcacccgtcgcggccctggct
gtggcgctggtctcgtcgctctctcgctgctccctcctggagccggaggaccgcgtggtc
tcgccgctcagcccctacttcggcaccaagactcgctacgaggatgccaaccccgggctg
ctgccggaccccgaggcgccacggcgggacccacaactgctggaggagacctgcatcccg
gtacagctggtcgccctcatccgccacggcacccgctacccgactaccaaacagatccgc
aagctgcggcagctgcacggactgctgcaggcccgcgggcccggggatgaccggatccgc
gctgccggcggcggcgacctgggcgctgtgctggctaactggccgctgtggtacgcggac
tggatggacgggcagctggtggagaaggggcggcaggacatgcgacagctggccctgcgc
ctggcctcccttttcccggtcctcttcagccgagaaaactgcggccgcctgcagctagtc
accagctccaagcaccgctgcgtggacagcggcgccgccttcctgcagggactgtggcag
cactaccaccctgggttaccgccgcccgacgtcgcagacatggagtgtggacctccaaga
attaatgataaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaa
aggaatgctacggctctttatcatgtagaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcaggtattttgcaagtgccagtcaacaacttaaatgcagattta
attcaggtagcttttttcacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggttttagaatacttaaatgatctgaaa
caatattggaaaagaggatatgggtatacgattaatagtcaatccagctgcaccctgttt
caggatatctttcagcacttggacaaagcagttgaacagaaacaaagttctcaaccaatt
tcctctccagtcatccttcagtttggtcatgcagagacccttcttccactgctttctctc
atgggctacttcaaagacaaggagcccctaacagcttacaattacaaggagcaaacgcat
cggaagttccgaagtggtcacattgtaccctatgcctcaaacctaatatttgtgctttac
cattgtaaaaatgctaagactcctaaggaagaattccaagtgcagatgttactgaatgaa
aaggtgttaccattggctcactcacaagaaactgtttctttgtatgaagatctgaagaac
cactacaaggacatccttcagagttgtcacaccagtgaagaatgtgaactaccaaaggtg
aacacatctgatgagctatga

DBGET integrated database retrieval system