KEGG   Delphinapterus leucas (beluga whale): 111172835Help
Entry
111172835         CDS       T05885                                 

Gene name
PPIG
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase G
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dle03041]
    111172835 (PPIG)
   03110 Chaperones and folding catalysts [BR:dle03110]
    111172835 (PPIG)
Enzymes [BR:dle01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111172835 (PPIG)
Spliceosome [BR:dle03041]
 Complex C
  Other components
   PPlases
    111172835 (PPIG)
Chaperones and folding catalysts [BR:dle03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111172835 (PPIG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase SR-25
Motif
Other DBs
NCBI-GeneID: 111172835
NCBI-ProteinID: XP_022425690
UniProt: A0A2Y9MUW7
Position
Unknown
AA seq 751 aa AA seqDB search
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKARKEEKKRHKSSSSSSSSSSDSDSSSDSQSSSDSSDSESASEEKSKKRKKKHRKNSRK
HKKEKKKRKKSKKSASSESEAENLEAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERK
NRERERECNLLNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPPHW
RQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKEKKITDHRHVSESPNRKSEK
EKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDTKHNRHEE
KRMRSRSKERDHENVKEKEKSDPKGKDQERSRSKEKSKQLESKSNEHDHNKSKDKDRRAQ
SRSRERDVTKGKHSYNSRTRERSRSRERSRRVRSRSHDRDRSRSKEYHRYREQEYRRRGR
SRSRDRRATPGRSRSKDRRRRRRDSRSSEREESQSRNKEKYRNQESKSSHRKENSEGEKR
MYSKNRDHSSSNSNREKKADRDQSPFSKMKQSSQDNELKFSTLKNKEDEKTRSSVEKENQ
KSKGQENDHTHDKNKKFDHESSPGTDEDKSG
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaaggttcagcgtcctcgatgtttttttgacatcgccattaataatcaacct
gctggaagagttgtctttgaattattttccgatgtgtgccccaaaacatgcgagaacttt
cgttgtctttgtacaggtgaaaaggggacagggaaatcaactcagaagccattacattat
aaaagttgtctctttcacagagttgtcaaagattttatggttcaaggtggtgacttcagt
gaaggaaatggacgaggaggggaatccatttatggaggattttttgaagatgagagtttt
gctgttaaacacaacaaagaatttctcttgtcaatggccaacagagggaaggatacaaac
ggctcacagttcttcataacaacaaaaccaactcctcatttagatgggcatcatgttgtt
tttgggcaagtgatttctggtcaagaagttgtgagagagatagaaaaccagaaaacagat
gcagctagcaaaccatttgctgaggtgcggatactcagttgtggagagctaattcccaaa
tctaaagctaggaaagaagaaaagaaaaggcataaatcctcctcctcctcatcatcatca
tccagtgactcagatagttcaagcgattctcagtcctcttctgactcttctgattctgaa
agtgcttctgaagagaaatcaaaaaaaagaaagaagaaacataggaaaaattctcgtaaa
cacaagaaagaaaagaagaagcgaaagaaaagcaagaaaagcgcatctagtgaaagtgag
gctgaaaatcttgaagcacaaccccagtctactgttcgtccagaagaaatccctccaata
cctgaaaatagattcctaatgagaaaaagtcctcctaaagctgatgaaaaagaaaggaag
aacagggagagagagagagagtgtaatctacttaactcccagcctgcttcataccagagg
cgacttttagttactaggtctggcaggaaaattaaaggaagaggaccaaggcgttatcga
actccttctagatccagatccagggatcgtttcagacgtagtgagactcctccacattgg
aggcaggagatgcagagagctcaaagaatgagggtatcaagtggtgaaagatggatcaaa
ggggataagagtgagttaaatgaaataaaagaaaatcaaagaagcccagttagagtaaaa
gagaaaaaaataactgatcataggcatgtttctgagagtccaaacagaaaaagtgaaaag
gaaaagaaagttaaagatcataaatctaacagcaaagagagagacatcagaagaaattca
gaaaaagatgataaatataaaaacaaggtaaagaaaagggccaaatcgaaaagtaggagt
aagagcaaagagaaatccaagagtaaggaaagagatacaaagcataatagacatgaagaa
aagaggatgaggtcaaggagtaaagaaagggatcatgagaatgttaaagaaaaagaaaag
tctgatcctaaaggaaaagatcaggaaaggagtagaagtaaagagaagtctaaacagtta
gaatccaaaagcaatgagcatgatcataataaaagtaaggacaaggacagacgtgcacag
tctaggagtagagaacgcgatgtaactaaaggcaaacacagttacaatagtagaacaagg
gaacgaagcagaagtagggagaggagcagaagagtgcggtctagaagccatgaccgagat
cgcagcagaagcaaggagtatcacagatacagagaacaggagtacaggagaagaggaagg
tcacggagccgagacagaagagcaacgccaggaagatcaagaagtaaagacaggaggaga
aggaggagagattcacggagctcagagagagaagaaagtcaaagcagaaacaaagaaaaa
tacagaaaccaagaaagtaaaagttcacacagaaaagagaattctgagggtgagaagaga
atgtactctaaaaatcgtgatcatagtagctcaaatagtaacagggaaaaaaaggctgat
agagatcaaagtccgttctcaaaaatgaaacaaagtagtcaggacaatgaattaaagttc
tcaactttgaaaaataaggaggatgagaagaccagatcctcagtggaaaaagaaaaccaa
aaatcaaagggtcaagaaaatgaccacacacatgataaaaataaaaaatttgatcatgaa
tcaagccctggaacagatgaagacaaaagtggatga

DBGET integrated database retrieval system