KEGG   Delphinapterus leucas (beluga whale): 111172919Help
Entry
111172919         CDS       T05885                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05410  Hypertrophic cardiomyopathy (HCM)
dle05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    111172919 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    111172919 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111172919 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111172919 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dle04812]
    111172919 (TTN)
   04147 Exosome [BR:dle04147]
    111172919 (TTN)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111172919 (TTN)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111172919 (TTN)
Membrane trafficking [BR:dle04131]
 Others
  Actin-binding proteins
   Others
    111172919 (TTN)
Cytoskeleton proteins [BR:dle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111172919 (TTN)
Exosome [BR:dle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111172919 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Titin_Z Pkinase Ig_6 fn3_4 C1-set PPAK Pkinase_Tyr SusE Adeno_E3_CR1 THB
Motif
Other DBs
NCBI-GeneID: 111172919
NCBI-ProteinID: XP_022425848
UniProt: A0A2Y9N9C3
Position
Unknown
AA seq 34744 aa AA seqDB search
MELERVPKKMTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTL
PGVQISFSDGRASLKIPAVTTANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQ
SMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIHSSLDFQISQEGDLYSLLIAEAYPEDS
GTYSVNATNSVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTQIEKKIEAHFDA
RSIATVEMVVDGATGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPS
PVRHVRAPTPSPVRSVSPAGRISTSPIRSVRSPLLVRKAQMPTMPPGPEVPPPWKQEGYM
ASSESEMRETMVTSATQIRTEERWEGRYGIQEQVTISGATGAAASATFAAGAGAAGTAEV
KQETDKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVRIQPAQEQIKKEAEKTAV
TKVVVAADKAKEQELKARTREVITTEQEQVHVTHEQIRKETEKAFVPKVVISAAKAKERE
TRITGEITTKQEQKQITQEMTIQKAETAAASMVVVATAKPTALETILGAQEESVTQQDQM
HVTHEKIMKETRKTVVPKVIVAMPKVKEQDLVTRTREGITTKKEQVQITQEKMRKEAEKT
ALSTIAVATAKAKEQETILRTREEMAARQEQIQVTHGKVGVGEKAEAVATVVAAVDQARV
REPREPGHVEEMYAQKTTLEYEHKERVSAAEVTEHPPRPASEPHIVPKAVKPGVIHAPSE
THITTTDQMGMHISSQIKKTTDLTSERLVHVDKRPRTASPHFTVSKISVPKPEHGYEASI
AGSAIATLQKELSATPSAQKVTKSVKPPTVKPAEARARAEPTPSPQFPFVDTPETFKSQA
DIEVKKEVGVSITGGAAREEHFEVLHEREAKVTETARIPAPVEIPVTPPTLVSGLKNVTV
IEGESVTFECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFT
CSAVNEAGTVSTSCYLAVQVSEEFEKETAVAEKITTEEKRFVESRDVIMTDTSITEEPAG
PGEPAAPFFITKPVVQKLVEGGSIVFECQVDGNPKPHVYWKKSGVPLTTGYRYKVSYNKQ
TGECKLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYESLMKSQQEMLYQTQMPA
FVQEPKVGEIAPGYVYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISSFEERLI
KEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVEAGFDLRVKNYRILEGMGVTFHCKMS
GYPLPKIAWYKDGKRIRHGERYHMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAIC
SGKLYVEPAAPLSAPTYIPTPEPVSRIRSISPRSVSRSPIRMSPARMSPLRMSPARMSPG
RRLEETDESQLERLYKPVFVLKPTSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND
YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGKSSISVILTVEAVEHQVKPVFVE
KLKNLNIKEGSRLEMKVRATGNPNPDIIWLKNSEIIVPHKYPKIRIEGAKGEAALKIDST
VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL
HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH
DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL
VEESQLPEGRKGLQRIEELERMAHEGALTSVTTDQKEKQKPDIVLFPEPARVLEGETARF
RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV
IEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPADTTETKEIVRLK
RAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH
WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGHGSDVHFRVR
VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET
SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGVEVHTGDKY
RMLSDRKVHFLSVLTVDTSDAEDYSCVLAEDENIKTTAKLIVEGAVIEFVKELQDIEVSE
SFSGELECIITPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVV
DGKKTTCKLKMKPRPVAILQGLSDQKVCEGDIVQLEVKVSLEKVEGVWMKDGEEVQPGDR
VHIVIDKQSHMLLIEDMTKEDAGHYSFTIPALGLSTSGRVSVYSVDVITPLKDINVLEGT
KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTYASDEGPYKLMVG
RVETSCDLSVEKIKIIRGLHDLTCTETQNVVLEVELSHSGIDVLWNFKDKEIYPSSKYKI
EAHGKIYKLTILNMMKDDEGEYIFYAGENMTSGKLIVAGGAISKPLTDQTVAESQEAVFE
CEVANPDSEGEWLKDDKHLPLSKNIRSKSDGHKRRLIIAATKLDDIGEYTYKVATSKTSA
KLKVEAVKIKKTLKNLTVTETQDAVFTLELTHPNVKGVQWIRNGVVLESNDKYTISVKGT
IYSLRIKNCAVVDESVYGFKLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH
DTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPLDAGEYTAVVGQLECKAKLFVE
TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII
MNTSTEDSAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK
WLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHVGDAAGYTFVAGKATSTATLYVEARHIEF
RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQLVDRIKIQKEKYVHRLLIPSTR
MSDAGKYTVVAGGNMSTASLFVEGRDVRIRSIKREVQVIEKQRAVVEFEVNEDDVDAHWY
KDGIEINFQLQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNAPEPPQ
ILQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE
AFPEDAAVYTCEAKNDYGIVTTSASLSVEVPEVVSPDQEMPVYPPAIVTPLQDTVTSEGR
PAHFQCRVSGTDLKVSWYSKDKKIKPSRFFKMTQFEDTYQLEIAEAFPEDEGIYTFVASN
AVGQVSSTATLRLEAPESMLHEQIEMEMKEFSSSLLSAEEEGPQTSSSGLQLSNRNETLE
LLSEPPVHSTKFDSKKEGSVPVFIKEVSNAEISIGDVAKLSVTVTGIPKPQIQWFFNGVM
LTPSADYKFVFDGNDHSLIILFTKLEDEGEYTCIASNEYGQAICSAYLKINSKGEGLQEP
ESAEEKSLEKLEGPCPPYFLKELKPIHCAQGLPAIFEYTVLGEPAPTVSWFKENKQLCTN
VYYTIIHNPDGSGTFIVNDPQKEDSGFYVCKAENVWGESTCAAELLVLLEDTHMTDAPCK
ATSTPEAPEDFPQTSLTVPAVEALDSEQETAAFVKDTILKAALIAEGKQQLSYEHIVKTN
ELSSQVTFIAEQLQSTVMLQQDMPTPESISELLSISDTIHVQPIKEPPPNVQLQIVQSQD
TFPKEDILMYQEPELQVVLSDTEKIFPSAMSIEEISSLTVESLQTLLAEPEGSYPQSSIE
ETPAHSYPTSVAEEVLLPKEKVVSTVDEEQRVILQEQEAQSALILNQSLAEGHVESFQGP
DIMISRVPSEHTCTEGEILMESVDQLDSAKQDFAASIEEGKSLRFPLAGEEKQVLLKEER
LDSLAMPPNQTTKYKKEPMAINGVQEVQGSDLLSKESLLSAIPEEQRLNLKTQIRRALQA
AVASEQLSLFSEWLRNIEQVEVKAIDFTQEPNRIMCTYFITSVKSLTEELAITIEGIDPQ
MANLKTELKEALCSIICEEMNILTAEEPGIQKGATTDLQEEMDSFSNPQKVEAITEPEVE
SKYLVLKEEISYFKVESQVKAVGATTASAAVSDEKLDEIPKPSEEKEKSPEGGTEKAGTV
EIREAEGSSLREGGPDVQTPLVDTIAKEGDTVRLASSITNAKEVNWYFESKLVPSDEKFK
CLQDQNTYMLVIDKVNREEHQGEYTCEALNDDGKTATSAKLTVVKRAAPVIRRRIEPLEV
ALGHLAKFTCEIHSAPSVRFQWFKAGREIYESDKSSIRSANYVSTLEILRTQAVDCGEYT
CKASNEYGSVSCTATLTVTEAYPPAFLSRPKSITTFVGKAAKFLCTVTGSPVIETIWQKD
GVALSPSPNCRISDANNKHILELSNLTIQDRGVYSCKASNKFGADTCQAELVVIDKPHFI
KELEPVQSAVNKKVHLECQADEDRKVTVTWSKNGQKLPSGKDYKICFEDKIASLEIPLAK
LKDTGTYVCTASNEAGSSSSSATVTIREPPSFVKKVDPSYLMIPGESARLHCKLKGSPVI
QVTWFKNNKELTESNTIRMSFVNSEAVLDITDVKVEDSGNYSCEAVNDVGSDSCSAEMVI
KEPPSFIKTLEPADIVRGTNALLHCEISGTGPFEIRWFKDKKQIRSSKKYRLFSQKSVVS
LEIFSFNSADVGEYECVVANEVGKCGCLATHLLKEPPIFVKKVDDFTALAGQTVTLQAAV
KGSEPISVTWMKGQKIIKEDGKIKMSFANGVAVLIIPDVQISFADKYTCLAENEAGSQTS
VGELIVKEPAKIVERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLIGSKKYRISF
KNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVS
GTCRLDCKIAGSLPMRVSWFKDGKEIASSDRYRIAFVEGTASLEISRIDMNDAGNFTCRA
TNSMGSKDCSGALIVQEPPSFVTKPASKDVLPGSTICLKSTFQGSTPLTIRWFKGDKELV
SSGNCYITKEALESSLEYYVVKTSDSGTYTCKVSNVAGAVECSAKLFVKEPATFVEKLEP
SQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHKMSFVESTAVLTLKDVAIDDS
GEYMCEAQNEAGSDHCGSILIVKESPYFTKEFKPIEVLKEYDVTLLAEVAGTPPFEITWF
KDNTTLRSGRKYKTFIQDQLVSLQILRFVAADAGEYQCRVTNEVGSSACSAKVTLREPPA
FVKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSG
IEIKHDGKYVCQAKNDAGVQRCSALLSVKEPATIIEEAVSIDVTQRDPATLQVKFSGTKE
ITAKWFKDGQELTLGQKYKISITDTVSILKIISTEKRDSGEYTFEVQNDVGRSSCKASIN
VLDLIIPPSFTKRLKKMDSIKGSFIDLECIVAGSHPMSIQWFKDDQEITASEKYKFSFHD
NTAFLEISQLEGTDSGTYTCSATNQAGHSQCSGHLTVKEPPYFLEKPQSQDVNPNTRVQL
KALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTILELFSAKAADLGTYICQLSNDVG
IATSKATLFVKEPPHFIKKPSPVLVLRNGQSTTFECQITGTPEIRVSWYLDGNEITAIEK
HGISFTGGLATFQISGARVEHSGTYVCEARNDAGTASCSIELKVKEPPTIIRELKPAEVV
KDSDVELECEVMGTSPFEVTWLKNNKEIRSSKKYTLTDRVSVFNLNINKCDPSDTGEYQC
IVSNEGGSCSCSARVSLKEPPSFTKKIENVTTVLKSSATFQSTVVGSPPIFITWLKDDQI
LDEDDNVHISFVNNVATVQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQILEKP
KSVDVTEKDPVTLECLVAGTPELIVKWFKDGKQMMPSRYFSMSFENNVASFRIQSVMKQD
SGAYTFKVENDFGSSSCDTYLRVLDQNIPPSFTKKLSKMDKVLGSSIHMECKVSGSLPIS
AQWFKDGKEITTSAKYRLVCHENAVSLDVSNLELEDTANYTCKVSNVAGSEACSGILTVK
EPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKVKWFKDDVELASGPKYFIGLEGSTTFL
NLYSVDASKTGQYTCQVTNDVGSDSCTTVLLVTEPPKFAKKLEATKIVKAGDSARLECKI
TGSPDIRVVWYRNEHELPASDKYRMAFIDSLAVIQMNSLGTEDSGDFICEAQNAAGSTSC
STKVIVKEPPVFSSFPPVVETLKDAEVSLECELLGTPPFEVVWYKDKRQLRSSKKYKIAS
KNFHASIHILSVNTSDIGEYHCKVQNEVGSDTCICTVKLKEPPRFVSKLNSLTVVAGEPA
ELQASIEGTQPISVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKN
DGGMRENMATLTVLEPAVIVEKASSMAVTAGETCTLECKVAGTPELSVEWYKDGKLLTSS
QKHKFSFYNKISSLKILSVEKQDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPPSFTRSLK
DTVGVLGTSCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCALQLNSLDSSDM
GNYTCMAANVAGSDECRAVLAVQEPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFKVGWF
RGARELVKGDRCNIYFEDTVAELELFNVDTSQSGEYTCVVSNNAGQTSCTTRLFVKEPAV
FVKKLSGHSVEPGKSIILESTYTGTLPISVTWKKAGVNITPSEKCNIVTTEKTCILEILN
STKGDAGQYSCEIENEAGRDVCEALVSTLEPPYFVTELKPLEASVGDSVSLQCQVAGTPE
VTVSWYKGDTKLRSTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKAVFR
IQESQLPPSFARQLKDTEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVD
NVATLKILQTDLSHSGQYSCSASNSLGTASSSARLTAREPKKSPFFDIKPVSIDIIAGES
ADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATN
DVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESPKLECKISGSPEIKVLWFRNDGELHE
SWKYNMSFMDSVASLTINEASTEDSGDYICEAHNGVGDASCSTALTIKAPPVFTQKPSPV
GALKGSDVIFQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLEAADVGE
YHCKAANEVGSDTCVCTVKFKEPPRFVKKLSDTSTLAGDAVELRAIVEGFQPIAVVWLKD
KGDIIRESENTRISFIDNIATLQLGSPEASNSGKYVCQIRNDAGMRECSAVLTVLEPARI
IEKPEPMTVTTGDPFALECAVAGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCA
EMSDKGLYSFEVKNNVGKSNCTVSVHVSDRVVPPSFIRKLKDTNAILGASAVLECRVSGS
APISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSFLEPSDTGTYTCVATNVAGSDECSAV
LTVQEPPSFEQTPDSLEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVSGESCSISLEDF
VTELELFEVEPLQSGEYSCLVANNAGSASCTTHLFVKEPATFVKRLADFSVETGNPIVLE
ATFTGTPPISVSWMKNEFPLTQSRNCSITMTEKSTILEILDSTIEDYAQYSCLIENEAGQ
DICEALVSVSEPPYFIEPLEHMEAAVGEPVTLQCKVDGTPEIRISWYKEHTKLRSAPAYK
MQFRNNVASLVINKVDPSDVGEYTCKAENSVGAVASSAVLVIKERKLPPSFARKLKDVQE
TLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHVGQYN
CSASNPLGTASSSAKLILLDHEVPPFFDLKPVSVDLALGESGSFKCHITGTAPIKITWAK
DNREIRPGGNYKMTLVENTATLTVLKVGKVDAGQYTCYASNVAGKDSCSAHLGVQEPPRF
IKKLEPSRIMKQDESTRYECKVGGSPEIKVLWYKDETEIQESSKFRMSFHDSVAVLEMHA
LSVEDSGDYTCEACNAAGRASSSTTLKVKEPPVFRKKPRPVETLEGADVHLECELQGTPP
FQVSWHKDKRELRSGKKYKIMSENFLTSIYILSVSAADVGEYQCKATNDVGGDTCVGSIT
LKAPPRFVKKPSDISAIVGEEVQLQAAIEGTEPISVVWFKDKGEMVRESDNIWISYSENI
ATLQFSRVETANAGKYTCQIKNDAGMQECFATVSILEPAAIVEKPESIKVTTGDTCTLEC
MVTGTPELTTKWFKDAKELTSDSKYKISFFNKISGLKIINVAPSDSGVYSFEVQNPVGKD
SCTASVHVSDRIVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRK
YQTTLTDNTCALTVNMLEDSDAGDYTCIATNVAGSDECGAPLTVREPPSFVQKPDPMDVL
TGTNVTFTSLVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTC
IVSNEAGKASCTTHLYVKAPAKFVKKLNDYSLEKGKPLILEGTYTGTLPISVTWKKNGTN
ITPSQRCHITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQL
EPVKVTIGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDSND
SGEYICRAENSVGEVSSSTFLTVQEEKLPPSFSRQLRDVQETVRLPVVFECAVSGSEPIL
VSWFKDGKPLKDSPNVQTSFLDNVATLNIFQTDRSFAGQYSCTATNPIGSASSSARLILT
EGKNPPFFDIPLAPVVAVVGDSADFECHVTGTQPIKVTWAKDNREIQSGGNYQISYLENS
AHLTILKVDKGDSGQYTCYAVNEVGEDSCVAQLNIKERLIPPSFTKKLSETVEETERNSF
KLEGRVAGSQPISVAWYKNNIEIHPTSNCEITFKNNTLLLQVKKAGMDDAGLYTCKVWND
AGSALCTSSVVIKAPKKPPVFDQHPTPVTVNEGEFVQLSCHVQGSEPIRIQWLKAGREIK
PSDRCSFSFANGTAVLELKDVSKADAGDYVCKASNVAGSDTCKSKVTIKDKPAAVPAAKK
AAVDGKLFFISEPQSMRVVEKTTATFIAKVGGDPVPDVKWTKGKWRQLSQGGRIFIHQKD
GEAKLEIRGTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKQQEKIEGDLRAMLKKTPAL
KKGAGEEEEIDIMELLKNIDPKEYEKYARMYGITDFRGLLQAFEMLKQSQVEETHRLEIE
EIEKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDGVFEIDIKINYPEIK
LSWYKGTEKLEPSDKFEISIDGDQHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAW
ERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRYKTEVEHKVHKMIIADVR
AEDQGQYTCKYKDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWY
KGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKE
IKLEMKPPDIPDSRVPIPTMPIRAVPPEEIPRTAVPPIPLLLPSPEEKKPPAKRIEVTKK
AVKKDAKKVVTKPKEEAPPPKVPEVAKKPPPPTALIPAEAPEVIDVSSKAEEVKIMTITR
KKEVQKEKEAVYEKKQAVYEEKKVYIESLEEPYDELEVEPYTEPYEEPYYEEPDEEYEET
QVEAKREVHEEWEEDFEEGQEYYEREEGYEEGEEEWEETYQEREVIQVQKEAYEESRERK
IPAKVPEKKEVPPPKVVKKPVVEKIEKTSRRMEEVQVTKVPEVSKKIVPQKPSRTPVQEE
VIEVKVPAVHTKKMVISEEKMFFASHTEEEEVSVTVPEVQKKTVTEEKIHVAVSKKIEPP
PKVPEPPKKPVSEEVVPVPHLPKKVEPLPAKVPEVPKKPVPEEKKPVPVPKKEPAAPPKV
PEVLRKPVPEEKIPVPVAKKKEAPPAKVPEVQKRVVAEEKIIIVTEREESPPPAVPEVPK
KKVPEEKRPVPWKEEEVPPPKVPALPKKPVPEEKVPVPVLAAKKAPPPRAEVSKTTVVEE
KRFVGEEKPSVAVSQRVEVVRHEVSAEEEWSYSEEEERVCVSVYREEEREEEEVEVTDYE
VMEEPEEYVVEEELHFISEKADAEPAEVPKKKIVPKPKTPAKIEEPPPAKVPEVPKTIVP
EKRIPAAVPKKEKVPPTKVPEEPKKPVPEKRAPPKVAKIEEPPPTKVTERHMQIAQEEKV
HVAVTKKVEPPRPRVPEEPKRAVPEEKVPKLKPRKEEEPPVKVTELRKRAVKEQKVSIEV
PKREPPAAKEVTVTAEKEWAYTQEEETVSVQWEEEYEEHDYEEFEEYEPTEEYDQYEEYE
EHEFEHYEEYKEHEEYVTEPEKPTPVKPVQEEPVPTKPKIPPAKVPKKVVPEEKVPVPIP
KKLKPPPPKVPEEAKKVVEEKIHISITKREKEQVTEPADKVPMKPKRVVTEEKVPVPKKE
VAAPVRVPEVPKRQPEEIAFEEEAVTQVEEYFEEEEYIHEKEELITEEEGELITEEVVPV
VPVKVPEVPKKPVPEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVP
EVPKKPVPEEKVPVPVPEKVEAPPAKVPEVPKKPVPEKKVLVPAPKKVEVPSAKVLVVPK
KVITEEKEPTPVPKKVEAPSPKVPKKREPVPVPVRVPVALLREEKVVFEEEIVLEEEVLP
EEEEVPPAEEEIPPEEEEVPPEEEEFPPEEEEVPPEEEEILSEEEEVAPEEEEIPPGEEE
FVPEEEEVLPEIKAKVPVPARVPEVPKKPVPEKKVPVPAPKKVEPPPPKVPEVKKKVPEK
KVITPKKEEAPPATVPEVPKKVEERRIIVPKEEEVPPVEVFEEPEEPIPEEEIPEEPPRI
EEVEEVAPPRVPEVVKKAVPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVQKKEAPPAKV
PEVQKKVPEKKVPEKKVPVPKREAVPPAKGRAVLEEKISVAVHKKEVVKERAELEIVEAQ
VEEAREEEFHEVEEYFEEEFHEVEEVLKVEEYRAEEVHEVEEVHRVIEVLEAEEVEVYEK
PKAPPKGPEISEKIIPPKKPPTKVVLRKEPPAKVPEVPKKIVVEEKVHVSEEPKVPPAKV
PEAPKEVVPEKKVPVMPPKKPEVPPAEVPEAPKEVVPEKKVPVMPPKKPEVPPVTVPEAP
KEVVPEKKVPVMAPKKPEVPPAKVPEVPKAAVPEKKVPEAIPPKPESPPPAVPEVPPKEA
IPEKKVPVAPPKKPEALPAKVPEVPKEVVPEKKVAVPKKPEVPPAKATQEVVPEKKVPKA
PPKKLEAPPVTVPKVPQEVVPEKKVPKAPPKKPEAPPVTVPEVPQEVVPEKKVPKAPPKK
PEVPPVSVPEVPQEIVPEKKAPVAPPKQLEAPPITVPEAPKEVVPEKKVPVMPPKKPKVP
PVTVPEAPKEVVPEKVPVMPPKKPEVLPVTVPEAPKVIVPEKKVPVMAPKKPEVPPVTVP
EAPKEVVPEKKVPVMPPKKPEVPPAEVPEAPKEVVPEKKVPVMPPKKPEVPPAEVPEAPK
EVVPEKKVSVMPPKKPEVPPVTVPEAPKEVVPEKKLHVMPPKKPEVPPAKVPEVPKAAVP
EKKVPEAIPPKPESTPPAVHEEPEETAPEEPPAEVVEEPEPAPPPKVTVPPKKPVPEKKP
PAVIAKKPEPPPVKVPEVPKEVVPEKKVPPVVPKKPEVPPAKVPEVPKEVLPEKKVAVPK
KPEVPPAKVPEVPKKPVLEEKPVVPVPEKVESPPPEVYEEPVEIAPEEEEPVPVAEEKEP
EAPPPAVPEEPKKIVPEKKVPVIKKAEPPPPKEPEPEKKVIEKPKPKPKPPAPPPAPPKE
DLKEKMFQLKAISKKKVPEKPEALEAVELTPLKVLGGEKKVRKLLPEPKPQPKEEAVLKS
VLRKRPEEEPKEEPKEVEKIKKPAVPEPPPKAVEEVEAPPATVTKRERKVPEPAKVPEIK
PAIPLTAPEPKPKPEPEVKIIKPPPLEPTPAPIAAPVTVPVAGEKAEAKAPKEEAAKPKV
PITGVAKKTPSPIEAERKKLRPGSGGEKPPAEAPFTYQLKAVPLKFVKEIKDIVLTEAES
VGSSAIFECLVSPSTAVTSWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCV
LRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSCDLNKERDVVWRKDGKIV
VEKPGKIVPSIIGLMRALTINDADDSDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKP
IRDQHVKPKGTAVFTCVIAKDTPNIKWFKGYDEIPLEPTDKTEIVRDGNHIHLKIKNAVP
EDIDEYSVEIEGKRYSAKLTLGDREVELLKPIEDVTIYEKESASFDAEISEADIPGEWKL
KGELLRPSPTCEIKADGGKRFLTLLKVKLDQAGEVLYQALNAVTTAILTVKEIELDFAVP
LKDVTVPEKRQARFECVLTREANVIWSKGPDIIKSSDKFDIIADGKKHILVINNSQFDDE
GVYTAEVEGKKTSARLFVTGIRLKFISPLEDQTVKEGETATFVCELSHEKMHVVWFKNDV
KLHTSRTVLISSEGKLHKLEMREVTPDDISQIKAQVKDLSSTANLKVLEADPYFTVKLHD
KTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKQAKLKDKGEY
TCDCGTDKTKANVTVEAQLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPLT
ASPDCEIIEDGKKHILVLYNCQLDMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKV
FEKDEAKFECEVSREPKTYRWLKGTQEITGDDKTELIKDGTRHSLVIKSAAFEDEAKYIF
EAEDKHTSGKLIIEGIRLKFLTPLKDVTAKERESAVFTVELSHDNIRVRWFKNDQRLHTS
KLVSMHDEGKTHSITFKDLSIDDTSQIKVEAMGLSSEAKLTVLEGDPYFTGKLQDYTGTE
KSEVILQCEISKADAPVKWFKDGQEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDC
GTDKTSGKLEIEDREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQTPE
CEIKEEGKMHFLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGE
TATFHCELSYEDIPVEWYLRGKKLEPSDKVVTRSEGRVHTLTLRDVKLEDAGEVQLVAKD
FKTQANLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSKKYE
IVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVDFLRPLTDLQVKEKEMA
RFECEISRENAKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLVADEAEYSCEVRTAR
TSGMLTVLEEEAVFTKNLTNIEVSETDTVKLVCEVSKPGAEVIWYKGDEEIIETGRYETL
TVGRKRILIIQNAHLEDTGNYNCRLPSSRTDGKVKVHELAAEFISKPQNVEILEGEKAEF
VCSLSKESFAVQWKRDDKTLESGDKYDIIADGKKRILVVKDATLQDMGTYVVMAGAARAA
AHLTVIEKLRIIVPLKNTRVKEQQEAVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKD
LVYTLRIRGAQLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRITEPLKDIETMEKKSV
TFWCKVNRLNVRLNWTKNGEEVTFDNRVLYRIDKYKHSLIIKDCGFPDEGEYIVTAGQDK
SVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFE
KDGRIHRLIIKDCRLDDECEYACGVEDRRSRARLFVEEIPVEIIRPPQDILEAPGTDVVF
LAELNKDKVEVQWLKNNMIIVQGDKHQMMSEGKIHRLQVCDIKPRDQGEYRFIAKDKEAR
AKLELAAAPKIKTADQDLVVDVGQPLTMVVPYDAYPKAEAEWFKENEPLSSKTVDTTAEQ
TSFRISEAKKGDKGRYKIVLQNKHGKAEAFINLQVIDVPGPVRNLEVTETFDGEVSLAWE
EPLTDGGSQIIGYVVERRDIKRKTWVLATDRADSCEFTVTRLQKGGAEYLFRVSARNRVG
TGEPVETDSPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRD
KTSVRWETAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFIKVADPIER
PSPPVNLNSSDQTQSSVQLTWEPPLKDGGGPILGYIIERCEEGKDNWIRCNKKLVPELTY
KVTGLQKGNKYLYRVSAENEVGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNP
IKILVPSTGYPRPTATWSFGDKVLEAGDRVKMKTLSAYAELIISPSERPDKGIYTLKLEN
RVKAISGEIDVNVIARPSAPKELKFGEITQDSVHLTWEPPDDDGGSPLTGYVVEKREVSR
KTWTKVIDSVSNLEFTVADLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAPATVPDPP
ENIKWRDRTAKSIFLTWDPPKHDGGSRIKGYIVEKCPRGSDRWVACGDPVAETKMEVTGL
EEGQWYAYRVKALNRLGASKPSKPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELP
ATVTGKPEPKVTWTKADMLLKQDKRITIENVPKKSTVTIVDSKRSDSGTYIIEAMNVCGR
ATAVVEVNVLDKPGPPAALDIMEVTNESCLLTWNPPRDDGGSKITNYVVERRATDSDMWH
KLSSTVKDTKFKATKLTPNKEYIFRVAAENMYGVGEPVQATPITAKYQFDPPGPPTRLEP
SDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPIKDTTYRVKGLTNKK
KYRFRVLAENLAGPGKASRSTEPILIKDPIDPPWPPGKPTVKDVGRTSLMLNWTKPEHDG
GAKIDSYVIEMLKTGTEDWVRVAEGVPTTEHLFPGLMEGQEYSFRVRAVNKAGESEPSEP
SDSVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQ
TVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEVEDSVLAKDTFTTPGPPYALT
VVDVTKGHVDLKWEPPKNDGGRPIQRYVIEKKEKLGTRWVKAAKTSGPDCNFKVTDVIEG
TEVQFQVRAENEAGVGHPSEPTEILKIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKN
GGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAVGVSEP
SEISENVVAKDPDCKPTIDLETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASD
RLTMKNDHISAHLEVPKSVHADAGVYTITVENKLGSATASINVKVIGLPGPCKDLKASDV
TKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFF
RVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAVTITWKPPLYDGGSKI
MGYIIEKIAKGEERWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRATPP
TKAVDPIDAPKVIMRTSLEVRRGDEIALDAIISGSPYPTITWLKDENVITPEEIRKRVAP
LVRRKKGEVQEEEEPFVLPLTQRLSIDSSKKGESQLRVRDSLRPDHGLFMIKAENDHGIA
KAPCTVSVLDIPGPPINFVFEDIRKTSVICKWEPPLDDGGSEILNYTLEKKDKTKPDSEW
IVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLTAKDPFEPPDAPDKPT
VEDVTSNSMLVKWNEPKDNGSPILGYWLERREVNSTHWSRVNRNLLNSLKTNVEGLLEGL
TYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGPPVPRVNDTSSTTIELAWEPPAFNGG
GEIVGYFVDKQLVGTNEWSRCTEKMIKAREYTVKEIREGADYKLRVSAVNAAGEGPPGET
EPVTVAEPQEPPNVELDVSVKAGIQIVAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRV
EIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNR
KMCLLNWSDPADDGGSDITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYMYRVI
AKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTINLDWKEPRSNGGCPIQGYI
IEKRRHDKPDFERVNKRLCPTTSLLVEDLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQD
DEVPPTIKLRLSVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTDALKITK
EEVSRSEAKTELSIPRATREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVVDIK
AESCHLTWDAPLDNGGGEITHYVIDKRDASRKKAEWEEVTNTAVERRYGIWKLIPNGQYE
FRVRAVNKYGTSDECKSDKVVIQDPYRTPGPPGKPTVLERTKGSMLVSWTPPLDNGGSPI
TGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGSPS
EPSDLAVAGDPIYPPGPPSRPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGTTD
WKSVNEPDKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEI
FIDIGAQDCLVCQAGTQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETA
ENSSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRL
TWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPNCGSTSFVVPDLISEQQYFFRVRAQNR
FGIGAPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVEC
LAWDPTGTKKEAWKQCNKRDVEELEFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPVT
VKDQTCPPSIELKEFMEVEEGTDVSIVAKIKGVPFPTLIWFKAPPRKPDNKEPVVYDTHV
NKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESIS
ADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECTYTIPKLLEDHEYVFR
IMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNYMTVNWEEPEYDGGSPVTG
YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPS
DPVTARDPTAPPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKITGYIVEYKEEGKEEWEKA
KEKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDAIEMKDRIVLPDLQLDASV
RDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNEKALPQEATIETTAISSSMVIKNCQRSHQ
GIYALLAKNAGGERKKTIIVDVLDVPGPVGIPFLSHNLTSDSCKLTWFSPEDDGGSPVTN
YVIEKREDDRRAWTPVTYTATRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETTDALVI
RDPITVPERPEDLEVKEVTKDSVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDN
LLSRKYSVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLELDFRDKLTI
RVGEAFALTGRYSGKPKPKVTWFKDEVDVLEDDCTHIKTSPTTLALEKLKAKRSDSGKYC
VVVENSTGSRKGFCQVNVVDRPGPPVGPVVFDEVTKDYMVISWKPPLDDGGSEITNYIIE
KKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFQIHAENLYGISDPLVSDSMKAKDRFR
VPDAPDQPIVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWARVTKEPIHPYTK
FTVPDLLEGCQYEFRVSAENQIGIGDPSPPSKPVFAKDPIVKPSPPINPEAIGTTHNSVD
LTWQPPRHDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETNYKVTGLQDGQSYKFRVI
AVNVARESDPAHVPEPVLVKDRFEPPELILDANMAREQHIRVGDTLRLSAVIKGVPFPKV
TWKKEDREAPTKARIDVTPVGSKLEICNAAHEDGGMYSLTVENLAGSKTVSVKVLVLDKP
GPPRDLEVSEVRKDSCYLTWKEPLDDGGSVITNYVVERRDVASVQWSPLSTTSKKKSHFA
KHLTEGNQYVFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKNLHHVDVDKTEVSLVW
NKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGL
GLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGNE
IKTDEHYTVETDNFSSVLTIKNCLRRDTGEHQITVSNAAGTKTVAVHLTVLDVPGPPTGP
INILEVTPEHMTISWQPPKDDGGSPVINYIVEKKDTKKDTWGVVSSGSSKTKLKVPHLQK
GCEYVFRVKAENKIGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSD
GGSPITGYYVERREVTGKWMRVNKTPLVDMKLRVTGLYEGNTYEFRAFAENLAGLSNPSP
SSDPIKACRPIKPPGPPINPKLKDKTRETADLVWTKPLSDGGSPILGYVVECQKAGATQW
SRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVEL
DVTCRDVITVRVGQTIRILARVKGRPQPDITWSKEGKALAREKRVDLIHDLPRAELQIKE
AVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKISNVTKENCTISWENPLDNGG
SEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANHEYYFRVCAENKVGVGPTTETKT
PILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERKLKGSDDWERV
HKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGV
LTVKAGDTIRLEAGVRGKPFPEVSWTKDKDATDLTRSPRVKIATSGDSSKFSLTKAKRSD
GGKYVITATNVAGSFVAFATVNVLDKPGPIRNLKIFDVCSDRCSLRWDPPEDDGGCEIQN
YILEKCESKRMVWSTFSAAILTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKSVIAK
TKYDRPGRPDPPEVTKVSKEEMTVVWTPPEYDGGKSITGYYLEKKEKHSTRWVPVNKSAN
PERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNLKVVDTTK
SSITLGWGKPVYDGGAPIIGYVVEMRPKRPDTSPDEGWKRCSAAAQLVRMEFTVTSLDEN
QEYEFRVCAQNQVGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIV
RGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNLAGEKAVF
VNVRVLDTPGPVSDLKVSDVTKTSCHISWAPPENDGGSQVTHYIVQKREADRKTWSTVTP
EVKKTSFHVTNLVPGTEYFFRVTAVNEYGPGVPTDIPKPVLATDPLSEPDPPRKLEVTEM
TKNSAALAWLPPLRDGGAKVDGYVVSYRDEELPAGHWTEYSVVKDLSLVVTGLKEGKKYK
FRVAARNAVGVSLPREAEGVYEAKAQLLPPKILMPEQIIIKAGKKLRIEAHVYGKPHPIC
KWKKGEDEVVTSSHLAVHKADNSSVLIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIVMD
VPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTS
CRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFDVPSEPKNARVTKVNKDCIFV
AWDRPDSDGGSPITGYLIERKERNSLLWVKANDSPVRSTEYPCAGLVEGLEYSFRIYALN
KAGPSPPSKPTEYVTARTPVDPPGKPEVTDVSKSTVSLIWARPKHDGGSKIAGYFVEACK
LPGDKWVRCNTSPHQIPQEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIMAEN
VPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTPLKASEGIKMAMQRNL
CTLELFSVSRKDSGDYTITAKNASGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWE
PPLEDGGSEITNYVVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGV
GDPILTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQ
AINWTKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDVSKAAYAQDPLYPPG
PPAFPKVYDTTHSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQKLQKTRFE
VTGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGELDADLRKTLILRAGVT
MRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTLKN
SCGTKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWDPPIIDGGSPIINYVVEKRDAER
KSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPSETRDAVKASETPGPVVDL
KVTSVTKSSCSIGWKKPRSDGGSRIIGYVVDILTEENKWQRVMKSLNLQYSMKDLTEGEE
YTFRVSAENENGEGTPSEITVVAKDDVVAPDLDLKDLPGLCYLAKENSNFRLKIPIKGKP
APSVSWKKGEDPLATDTRVSIESSAVNTTLVVNDCQKSDAGKYTITLKNVAGTKEGTLSI
KVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCASAV
QKTTFRVMRLLEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPSIVDVRHD
SVSLTWTDPRRTGGSPITGYHIESKERNSLLWKRANKTPVRMKDFKVTGLTEGLEYEFRV
MAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIV
EKRDLPSKSWMKANHVNVTDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICK
DEYEAPTIVLDPTIKDGLTVKAGDTIVLNAISILGKPLPKSSWSRAGKDIRPSDIVQITS
TPTSSMLAIKYATRKDAGEYTITATNAFGTKEEHVKVTVLDVPGPPGPIEVSNVSAEKAT
LTWTPPLEDGGSPIKSYVLEKRETSRLLWTVFAEDIQSCRHVATKLIQGNEYLFRVSAVN
QYGKGEPVQSEPVKMVDRFGPPGPPGKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER
REKKGLRWVRATKTPVSDLRFKVTGLQEGNTYEFRVSAENKAGIGPPSDTSNPVLMKDVA
YPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTTLRI
TEFVVPDLQTKEKYNFRISAINDAGVGEPAVISNVEIVEREMAPDFELDAELRRTLVVRA
GLSIRIFVPIKGRPAPEVTWTKDDINLKNRANIESTESFTLLIIPECNRYDTGKFVMTIE
NPAGKKSGFVNVRVLDTPGPVLNLRPTDITKESVTLHWDLPLIDGGSHITNYIVEKREAT
RKSYSTVTTKCHKCTYKVTGLSEGHEYFFRVMAENEYGIGEPTETTEPVKASEVPSPPDS
LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVKNLTEG
EEYTFQVMAVNSAGRSAPRESRPVVVKEQTMLPELDLHGIYQKLVIAKAGDNIKVEIPVL
GRPKPTVTWKKGDQVLKQTQRVNFENTATSTILNISECVRSDSGPYPLTARNIVGEVGDV
ITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA
ATVIRTTYKATHLTTGVEYQFRVKAQNRYGVGPGITSASVVANYPFKVPGPPGTPQVTAV
TKDSITISWHEPLSDGGSPILGYHIERKERNSILWQTVSKALVPGNIFKSSGLADGIAYE
FRVIAENMAGKSKPSKPSEPMSALDPIDQPGKPVPLNITRHTVTLKWAKPEYTGGFKITS
YIVEKRDFPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAI
TCRDDIEAPRIMVDIIFKDTIIIKAGEAFKLEADVSGRPPPTMEWTKDGKELENTAKLEI
KMADFSTNLVNKDSLRRDGGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAISEMTSE
KCVLSWLPPLDDGGAKIDNYVVQKRETSRLAWTNVASEVQVTRLKVTKLLKGNEYIFRVM
AVNKYGVGEPLESEPVLALDPYGPPDPPQNPEVTTITKDSMVVCWGHPDSDGGSEIINYI
VERRDKAGQRWVKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSATSPFYKAC
DAVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWHIVTPPAG
LKATSYTITNLTENQEYKIHIYAMNSEGIGEPALVPGTPKAEDRMLPPEIELDAELRKVV
TIRACCTLRLFVPIKGRPVPEVKWTREHGESLDKASIESTSSYTLLTVGNVNRFDSGKYI
LTIENSSGSKSAFVSVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKISNYIVEK
RESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPL
PPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWTTCATVKVTEATITG
LIQGEEYSFRVSAQNEKGISDPRQLSVPVVAKDLVIPPAFKLLFNTFTVLAGEDLKVDVP
FIGRPTPTATWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYVVKLTNSAGEAT
ETLNVIVLDKPGPPTGPVKMDEVTADSITFSWGPPKYDGGSSINNYIVEKRDTSTTTWQI
LSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPFVT
LSSKDCMEVQWNEPVSDGGSKVTGYHLERKERNSILWVKLNKTPIPQTKFKTTGLDEGIE
YEFRVSAQNIVGIGKPSKVSESYVARDPCDPPGRPEPITVTRNSVTLQWKKPTYDGGSKV
TGYIVEKKELPEGRWMKASFTNVIDTQFEVTGLAEDHRYEFRVIARNAAGVFSEPSESTG
AITARDEVEPPRIRMDPKYKDTIVVHAGELFNIDTDIYGKPVPATQWIKGDQELSNTARL
EIKSTDFATSLNVKDAIRVDSGNYTLKAKNVAGEVSVTVNVKVLDRPGPPEGPIVISGVT
AEKCTLAWKPPLQDGGSDIINYIVEKRETSRLVWTVVDANVQTLSCKLTKLLEGNEYIFR
IMAVNRYGVGEPLESEPVIVKNPFVVPDAPKAPEITAVTKDSMVVVWERPASDGGSEILG
YVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQK
ACDPIYKPGPPNNPKVIDTTRSSVFLSWGKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPP
TGINKTNIEVEKLSEKHEYNFRICAVNKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRK
IINIRAGGSLRLFVPIRGRPTPEVKWGKVDGEIRDAAIIDSTSSFTSLVLDNVNRYDSGK
YTLTLDNSSGTKTAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIV
EKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAHTDDPIKVAEV
PQPPGKITVGDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHHEKWSECARVKSLEAVI
TNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAFNNYSVQVGQDLKIE
VPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTILSIKETHKDDSGHYGITVANVVGQ
KTASIEIITLDKPDPPKGPVKFDEVSAESITLSWEPPLYTGGCQITNYIVQKRDTTTTVW
DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPTVAQYPYKEPGPPGTPF
VTAVSKDSMVIQWHEPINNGGSPIIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEG
IGYEFRVYAENIVGIGKASKNSECYVARDPCDPPGTPEAIIVKRHEITLQWTKPAYDGGS
MITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGVISKPSDS
TGPVTAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESA
RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTG
VTAEKCTLTWSPPLQDGGSNISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYI
FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKTLEVTNIAKDSMTVCWSRPDSDGGSEI
IGYIVEKRDKSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVY
YKACDPVFKPGPPINAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVT
PQTGLRATRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSEL
RKGIVVRAGGSVRIHIPFKGCPTPEITWSREEGEFTDKVQTEKAANYTQLSIDNCDRSDA
GKYTLKLENSSGSKSAFVTVKVLDTPGPIQNLAVKEVRKDFVLLIWEPPIIDGGAKVKNY
VIDKRESTRKAYANVSNKCSKTSFKVENLTEGAMYYFRVMAENEFGVGVPVETADAVKAA
EPPSPPGKVTLTDVSQTRASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKVCNA
VVTGLSSGQEYQFCVKAYNEKGKSDPRVLGVPVIAKDLTIQPSFKLPFNTYSVQAGEGLK
IEIPVIGRPRPEISWVKDGEPLKQTTRVNVEETATSTILHIIESNKDDFGKYTITATNSA
GTATENLSIIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTT
TWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKPVIVQYPFKEPGPPGT
PFVTSVSKDQMLVQWHEPVNDGGSKVTGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLD
EGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNSVTLKWKKPAYDG
GSKITGYTVEKKDLPDGRWMKASFTNVLETEYTVSGLVEDQRYEFRVIARNAAGNFSEPS
ESTGAITARDEIDAPNASLDPRYKDVIVVHAGETFVLEADIRGTPIPDIVWSKDGKELEE
TAARMEIKSTIQQTTLLVKDCIRSDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLK
VSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGN
EYIFRVMAVNKYGIGEPLESEPVVARNPYKPPGPPSPPEASAITKESVVVTWARPVDDGG
AEIEGYILEKRDKAGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEP
SVFYRACDALYPPGPPSNLKVADTSRSSVSLVWNKPIYDGGAPVKGYVVEVKEATAAEWT
MCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATIPGSVVAKERQEPPEIELD
ADLRKVVILRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSYTMLVIDNVTR
FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVGEVKKDSVTLAWEPPLIDGGAKI
TNYIVEKRETTRKVYATVTNNCTKNTFKIENLQEGCSYYFQVLASNEYGIGLPAETTEPV
KVSETPLPPGRVTLVDVTRNTATIKWERPESDGGSKITGYVVEMQTKGSEKWSMCTQVKT
LEATISGLTAGEEYIFRVAALNEKGKSDPRQLGVPVIARDIEIKPSVELPFNTFNVKATD
QLKIDVPFKGRPQATVSWKKDGQTLKETTRVNVSSSKTVTSLTIKEASREDVGTYELCVS
NSAGSVTVPITIIVLDKPGPPGPIHIDEVSCDNITISWNPPEYDGGCQISNYIVEKRETS
STTWHVVSQAVARTSIKIVRLVTGSEYLFRVCAENRYGKSSYSTSSAVVAEYPFSPPGPP
GTPKVVHATKSTMLVTWQVPVNDGGSQVLGYHLEYKERSSILWSKANKSLITATQSKVSG
LDEGLMYEYRVYAETIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHY
DGGAKITGYIVERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFARNAADSTSE
PSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGVEI
EERARTEIVSTDYNTLLTVKDCVRRDSGQYVLTLKNVAGTRSFAVNCKVLDKPGPPAGPL
EITGLTAEKCSVSWGPPQEDGGAAIDYYIVEKRETSRLAWTICEGELRTTSCKVTKLLKG
NEYIFRVTGVNKYGVGEPLESMAVKALDPFTVPSPPTSLEITSVTKEFMTLCWARPESDG
GSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSE
TSPLIQAEDPVFLPSPPSKPNIMDSGKTNITIGWVKPLFDGGSPVTGYTVEFKKSDETDW
KTAIQNLRGTEYTVSGLTTGAEYIFRIRSINKVGASDPSDSSDPQIAKEREEEPVFDLDS
EMKKTLIVKAGASFTVTVPFRGRPVPSVSWSKPDTDLRTRAYIDSTDSHTSLTIENANRN
DSGKYTLTIQNILNAASLTLVVKVLDSPGPPANITVHDVTRESAVLSWDVPENDGGAPVK
NYYIEKREASKKAWVSVTSNCNRLSHKITNLQEGEIYYFRVSGENEFGVGVPAETKEGVK
ITEKPSPPEKLGVTSVSKDSVSLAWLKPEHDGGSRIVHYVIEALEKGQKNWVRCAVVKST
HHVISGLRENSEYFFRVFAENQAGLSDPRELLLPVLVKEQLEPPEIDMKNFPSHTVYVRS
GSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESIAADAGRYEIT
AANSSGTTKAFINIIILDRPGPATGPVVISDVTEESVTLKWEPPKYDGGSQVTNYIVLKR
ETSTAVWTEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDSACVVVKLPYTTP
GPPSTPWVTKVTRESITVGWHEPVSSGGSAVIGYHLEMKDRNTILWQKANKMVIRTTHFT
VTTISAGLVYEFRVYAENAAGIGKPSHPSEPVLAIDACEPPRNVRITDVSKNSVNLSWQQ
PAYDGGSKITGYIVERRDLPDGRWAKASFTNVTETQLTVSGLTQNSQYEFRVFARNAVGS
ISNPSEVAGPITCIDSYGGPVIDLPLEYTEVVKYRAGASVKLRAGISGKPEPTIEWYKDD
KELQTSALVCVENTTDLAAILIKDATRLNSGSYELKLRNAIGSASATIRVQILDKPGPPG
GPIEFKTVTATKITLLWQPPADDGGAKVTHYIVEKRETSRVVWSMVSENLEEYIITTTKI
IKGNEYIFRVRAVNKYGIGDALESHPVVAKNAFVTPGPPSVPEVTKITKNSMTVVWNRPV
ADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTEHSDYQYRVCAINAAGQGP
FSEPSDFYKAADPIDPPGPPAKIRIEDSTKSSITLGWSKPVYDGGSAVTGYVVGMRQGEE
EEWTVVSTKGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPIEMTEPVQAKDILEEPE
IDLDVAFRTSIIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIQNTDSSSLLT
IPQVTRNDTGKYILTIENGVGQPTSSTVSVKVLDTPAACQKLQIKHVSRGTVTLLWESPL
IDGGSPIINYIIEKKDATKRTWSSVSHKCSSTSFKVTDLSEKTPFFFRVLAENEIGIGEP
CETTKPVKAAEVPAPIRDLSVKDSTKTSVTLSWTKPDFDGGSVITDYTVERKGEGEQTWS
HAGVSKTCEIEVSQLKEHSVLEFRVSARNEKGLSDGVTIGPITVKELVIPPQVDLSEIPG
AQVTVRIGHNVHLELPYKGKPKPSISWLKDSLPLKESERVRLSKTENKLTLSIKNAKKEN
GGKYTIILDNAVCRNSFPITIITLGPPSKPKGPIRFDEVKADSVIISWDVPDDDGGGEIT
CYSIEKREASQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLDSNIIVA
KHQFRIPGPPGKPVTYNVTSDGMSLTWDAPVYDGGSEVTGYHVEKKERNSILWQRINTSP
ISGREHRATGLMEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRET
ITLKWNPPLRDGGSKIVAYNIEKRQGSDHWTRCNFSDVSECQYTATGLSPGDRYEFRILA
RNAVGTISPPSQSSGVIMTRDENVAPIVEFGPEYFDGVTIKSGESLRIKALVQGRPVPRV
TWFKDGEEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYRVEAKNASGSTKAEITVKVQD
TPGKPVGPIRFTSITGEKMTLWWDAPLNDGCAPVSHYIIEKRETSRLAWALIEDNCEALS
YTATKLITGNEYQFRISAVNKFGVGRPLDSDPVVAQIQYTTPNSPGTPEPSNVTGNSITL
TWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAE
NAAGVGPASGISRLIKCREPVSPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYII
EMCKADLGDWHKVNAEGWVKTRYTVTDLQAGAEYKFRVSAVNGAGKGDSCEVTGTIKAVD
RLSAPELDIDANFKQTHIVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSIRADIHTTDSF
STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDSPGPPGPITFKDVTRGSVTLMWD
APLLDGGARIHHYVVEKREASRRSWQVVSEKCTRQILKVNDLVEGVPYYFRVSAENEYGV
GEPYEMPEPMVATEQPAPPKRLDVIDTSKSSVVLAWLKPDHDGGSRISGYLLEMRQKGSD
FWVEAGHTKQLTFTVEHLTENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLT
GITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTTDRTTLSVKDS
MRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEASSVSAESCILSWAEPKDDGG
TDITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA
PIVAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWVKE
NKLPCLECNYKVTSLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDAPGRPEVTDV
TRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTITALSEGD
TYEFRVLAKNAAGVISKGSESTGPITCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAA
VGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGRYTLTVKNASGTKA
VSVVVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIV
EGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSQPGIPEEVG
AGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDHVVYDTRLKVTGLMEGCD
YQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGG
TDIIGYVLEMQEKDTDQWYRVHTNTTIRNNEFTVTDLKMGQKYSFRVAAVNVKGMSEYSE
STAEIEPMERLEIPDLELADDLKKIVTIRAGASLRLMVSVSGRPPPVIIWSKKGIDLASR
AIIDNTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVS
RDSVTITWEVPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLIEGTMYYFR
VLPENIYGIGEPCETSDAVLVSEVPLVPVKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYV
LEACKAGTERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIITAVTVQ
DLRVLPAIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVAVETH
TKVAKLTIRETTIRDTGDYILELKNATGTTSETIKVIILDKPGPPTGPVKIEEIDATSVT
ISWGPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRLTEGNEYVFRIAVTN
RFGIGSYLQSEVIECRSRINIPGPPETLQIFDVSREGMTLTWYPPEDDGGSQVTGYIVER
KEVRVDRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINVRGTGKPSRPSKPTIAMDPI
APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQYEWTKCNTTPTKIR
EYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGICVRQ
GGVIRLTIPIKGKPFPICRWTKEGQDISKRAMIATSETHTELVIKEADRDDSGTYDLVLE
NKCGKKAVYIKVRVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREV
PKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPE
PPSNPPEVLDVTKSSVSLSWSRPRDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYT
ITGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQ
WEKPECDGGKEILGYWVEYRQSGDNAWKKSSKDRIKDRQFTIGGLLEATEYEFRVFAENE
TGLSRPRRTAMSVKTKLTSGEAPGVRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFG
KELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVESSSKLLLQATPQFHP
GYPLKEKYYGAVGSTLRLHVTYIGRPVPAITWFHGQKLLQNSENIAIENTEQYTHLVMKN
IQRKTHAGKYKVQLSNVLGTVDAILDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPADD
GGSWITNYVVEKCEAKEGVEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPL
EVSSVVIIKSPFEKPGAPGKPTIAAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNK
WIAVTKDEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVIPKSDVPIQAPHF
KEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIA
SVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKNLEGMGAVHALRGEVISIKIP
FSGKPDPVITWQKGQDLINNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGID
QKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWIR
VGQARETHYTVINLFGKTSYQFRIIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDE
TREVSMTKASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKTYMAKFVKVKGTDQV
LVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVS
YVRQVCEALEFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQAHQLKPGDNFRLLFTA
PEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQVIENIMNAEYTFDEEA
FQEISTEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLI
KKDLNLVVSAARISCGGAVRSQKGVSIAKVKVASIEIGPVSGQIMHAVVEEGGYVKYVCK
IENYDQSTQVTWYFGVRQLENSEKYEITYDDGVATMYVKDITKFDDGTYRCKVVNDYGED
SSYAELFVKGVREVYDYYCRRTIKKLKRRTDTMRLLERPPEFTLPLYNRTVYVGENVRFG
VTITVHPEPRVTWYKSGQKIKPGDDDRKYTFESDKGLYQLTINSVTTDDAAEYTVVARNK
YGEDSCKAKLTVTPHPPPTGTTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEK
DGQPLSLGPNTEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRY
VKQEFKTKEERERHVQRQIDKTLRMAEILSGTETVPLTQVAQEALREAATLYKPAVSTKT
VKGEYRLETEEKKEERKLRMPYEVPEPRKYKPAAIEEDQHIKQFVPMSDMKWYKKIRDQF
EMPGKMDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLSQDDLEMVRPARRR
TPSPDYYFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSR
SPPRFELSSLRYPSPQAHVKVEEARKGFRYSTYHIPTKAETSTSYAELRERHARTWHRQP
RQRQRIMAEREDQELLRPVTTTQRLSEYKSELDHMAKEEKSRRKSRRQREVTEITEIEEE
YEISKHAQRDTSSSVSRLLRRRRSLSPTYIELMRPVSELIRPRPQPAEEYEDEEDVERRS
PTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPF
TLDHMPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGV
LTLEILDCHIDDGGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPEL
TRTEAYAVSSFKKTSEMEASSSVREMKSQMTETRESLSSYEHHASAEMKSAAVEEKSLEE
KSTHRKIKTTLAARILTKPRSITVYEGDSARFSCDTDGEPVPTVTWLRRGQVISTSARHQ
VTTAKYKSTFEISSVQASDEGNYSVVVENSEGKQEAQFTLTIQKARVTEKALTSPPKVKS
PEPRVKSPEGVKSPKQVKSPEPVTSHPKAVSPTEIKPTPTEKVQQLPVTAPPKIIQSLKA
EASKDIAKLTCVVESTVLCAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLTESDC
GEYICEISGEGGTSKTNFQFVGQAFKNIHEEVSSISETKKAAQKTAVSTETKKAAPKTAE
PTETKKAAPKTAEPTETKKTEPKAPEPVSTKPVIVTGLQDTTISSDSVTKFAVKATGEPQ
PTVIWTKDGKAITQGGKYKLSEDKGGFFLEIHNTDTSDGGLYTCTVTNSAGSVSSSCKLT
IKAVKDTEIQKVSTQKTSKSTSQKKAAVQEEISKKALISEEIKMSEVKSPEKLALEEEAS
TVLISEKVKKSEATSLEKSIVHEEITKTSQASEEIRTHAEIKAYSTQMSIPDGQKVTLKA
NIAGATDVKWVLNGVELSNSEEYRYGVSGSDQTLTIKQAGHKDEGILTCIGKTSQGIIKC
QYDLTLSKELSDAPAFISQPRSQNVNEGQNVLFSCEISGEPSPEIEWFKNNLPISVSSNI
SVSRSRNVYSLEIRKASVSDSGKYTIKAKNFHGQCSATASLTVLPLVEEPPKEVVLRTSG
DTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSS
SSFMGKSSMTQLESSTSRMLKAGLRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEI
TWSHGGRKIQNQEQQGRFHTENTDDLTTLIIMDVQKQDGGLYTLSLENEFGSDSATVNIN
IRSI
NT seq 104235 nt NT seq  +upstreamnt  +downstreamnt
atggagttagagagagtgcctaaaaagatgacaactcaagcaccgacgtttacgcagccg
ttacaaagcgttgtggtactggagggtagtaccgcaacctttgaggctcacattagtggt
ttcccagttcctgaggtgagctggtttagggatggccaggtgatttccacttccactctg
cccggcgtgcagatctcctttagcgatggccgcgctagcctgaagatccccgccgtgact
acagccaacagtggacgatactccctgagagccaccaatggatctggacaagcgactagt
actgctgagcttctcgtgacagcagagacagcaccacccaactttgttcaacggctgcag
agcatgaccgtgagacaaggaagccaagtgcgactccaagtgagagtgactggaatccct
acacctgtggtgaagttctaccgggatggagctgaaatccacagctcccttgattttcaa
atttcacaagaaggcgacctctacagcttactgattgcggaagcgtaccctgaagactct
ggtacttattcagtaaatgccaccaatagcgttggaagagctacttccactgctgaatta
ctggttcaaggtgaagaagtagtacccgctaaaaagacgaagacaattgtttcgactgct
cagatttcagaaacacgacaaactcaaattgaaaagaagattgaagcccactttgatgcc
agatcaattgcaacagttgagatggtagtagatggtgccacggggcaacagctgccgcat
aaaacacctcccaggattcctcctaagccaaagtcaaggtctcccacaccaccatccatt
gctgccaaagcacagttggctcgacagcagtccccatcgccgataagacactccccgtcc
ccggtcagacatgtgcgggcaccgaccccatctccggtcaggtccgtgtctccagcgggg
aggatctccacgtcccccatcagatccgttaggtctccgttactcgtccggaaggctcag
atgcccaccatgcctccaggccctgaagtgcctcccccttggaagcaagagggctacatg
gcttcatctgagtctgagatgagagaaaccatggtgacaagtgctactcagatcaggaca
gaggagagatgggaagggagatacgggatccaggagcaagtgaccatcagcggagcgaca
ggggctgccgccagtgctacctttgcggcaggggctggtgctgctgggactgcagaggtg
aaacaagaaactgacaaaagtgcagctgttgcaaccgttgttgctgctgttgatatggcc
agagtgagagaaccagttatcagtgctgtagagcagactgctcagaggacaaccacgact
gctgtgcgcatccaacctgctcaagaacagataaaaaaggaggcagagaagactgctgta
actaaggtggtagtggccgccgataaagcaaaagaacaagaattgaaagcaagaaccaga
gaagtaattaccacagaacaagagcaggtgcacgtaactcacgaacagataagaaaagaa
actgaaaaggcatttgtaccaaaagtagtaatttccgcagctaaagccaaagaacgagaa
actagaataaccggagaaattactacaaaacaagaacaaaaacaaataacacaagaaatg
acaatacagaaagctgagacagctgctgcatccatggtggtagttgccactgccaagccc
acagccttagaaacaattctgggagctcaagaagaaagtgtcacacaacaagatcaaatg
catgtaactcatgaaaagataatgaaagaaactaggaaaacagtggtacctaaagtcata
gttgccatgcccaaagtcaaagaacaagatttagtaacaagaactagagaaggcatcact
accaaaaaagagcaagttcaaataactcaggaaaagatgagaaaggaagctgagaaaact
gccttgtctacaatagcagttgcaactgctaaagccaaagaacaagaaacaatactgaga
actagagaagaaatggctgctagacaagaacaaatccaagttactcatggaaaggtgggc
gttggggaaaaggcggaagctgtagcaacagtggttgctgcagtagaccaggcccgagtt
cgagagcccagagaacccgggcatgttgaagaaatgtatgctcagaagaccactttggag
tatgagcacaaggaacgcgtgtctgccgcagaggtaactgagcatccgccacgtccagcc
tcagaaccccacattgtccctaaagcagtcaagcctggagtgatccacgctccttctgag
actcatatcacaactacggatcaaatgggaatgcacatatcatcacagatcaagaaaact
acagatctaacaagtgaaagattagtccatgtggataaacgcccccgcacagcaagccct
cactttactgtttcaaaaatttctgttcctaagccagaacatggatatgaggcatcaata
gctggtagcgctatcgccacgttacaaaaagagttgtcagccacaccttctgctcagaag
gtcaccaaatccgtgaagccacctactgtgaagcccgctgaggctagagcgagagcagag
cccaccccttcaccccagttcccctttgtggacacaccagagacttttaagagtcaagct
gacattgaggtgaagaaggaagtcggggtgagcatcactggtggcgcagcccgtgaagag
cacttcgaagtactgcacgagcgtgaagccaaggtaacagaaacagcaagaatacctgca
cctgttgaaatccctgttacgccaccaactttagtctcgggcttaaagaacgtgactgtt
attgaaggtgaatctgtcaccttcgagtgccacatctctggatacccatccccaaaagtg
acatggtacagggaagactaccaaatagaaagctccattgatttccagataaccttccag
agtggaattgctcgtcttatgattcgtgaagcctttgcagaagacagtgggcgatttact
tgcagtgctgtgaacgaggctgggactgtcagcacatcctgctatctagctgtgcaagtg
tcagaagagtttgaaaaggaaacagctgtggctgagaaaattaccacagaagagaaacgc
tttgtcgaatcaagggatgtgataatgacagatactagcatcacagaggaaccagcaggg
cctggagaacctgccgctcctttctttattacaaaaccagtggtacagaaactggtagaa
ggcgggagcattgtatttgaatgccaggttgacggcaacccaaagccccatgtctactgg
aagaagtccggtgttcctctaaccactggatacagatacaaagtgagttacaacaaacaa
actggcgagtgcaaactggtgatttcgatgacgtttgccgatgatgctggagaatacact
attgttattcgtaataagcatggagaaacttctgcatctgcctccttgcttgaagaagct
gattatgagtcactgatgaagtcccagcaagaaatgctttaccagacacaaatgcctgca
tttgtgcaagaacctaaagttggagaaatagcacctggctatgtatactctgaatatgaa
aaagagtatgaaaaagagcaagccttaattaggaagaaaatggccaaagatactgtaatg
gtcagaacttttgtggaagaccaggaattccatatttcttcctttgaagagagacttatt
aaagaaattgaatacagaataataaagactacattagaagaacttcttgaagaagacgga
gaagaaaagatggcagttgacatttctgaatctgaagccgttgaagcaggatttgattta
agagtcaagaattacagaattcttgaagggatgggtgttacttttcattgcaagatgtct
gggtatccattacccaagattgcatggtacaaagatggcaagcgcatcagacatggagag
agataccatatggactttctacaagatggcagagctagtctgcgcatacctgttgttctt
ccggaagatgaaggcatctataccgcgtttgccagcaatattaaaggaaatgcaatttgc
tcagggaaattgtatgtggagcccgctgcgccacttagtgctccgacttacatacccaca
ccagagccagtgagcagaatcaggtccatctctccacgttcagtgagcagatctccgata
cgcatgtcccctgcacgaatgtcccctctacggatgtcccctgcacggatgtcccctgga
cgtaggctggaggaaacagatgagtcacagcttgagagactgtataagccagtctttgtg
ttgaaacctacttctttcaaatgtttagaaggacagactgccagatttgacttaaaggtc
gtgggtcgacctatgccagagaccttctggtttcatgacggtcagcaaattgtcaatgac
tatacccataaagtagtcattaaagaagatggtacccaatcactaattattgtccctgca
acacccagtgattctggagaatggactgtggttgcccaaaacagggcaggaaaatcatca
atttcagtgattttaactgtggaagctgtggaacatcaggtaaaaccagtgtttgtggaa
aaactgaaaaatctcaacataaaggaaggttcccgacttgaaatgaaagtcagagctacg
ggtaaccccaaccctgacatcatatggttgaaaaacagtgagatcattgtacctcataaa
tatccaaaaatcagaattgaaggagccaagggagaagctgcccttaaaattgactccact
gtcagccaagactctgcctggtacactgcaactgccattaataaggctggccgagacact
acaagatgcaaagtaaatgttgaagttgagtttgcagagcctgagccagagagaaaatta
atcatcccacgagggacatatagagcaaaggagattgcagccccagaactggagcccctc
catttgcgatatggtcaagagcaatgggaagagggtgacctctatgacaaagagaaacaa
cagaaaccatttttcaagaaaaaactcacttccttaagactcaagcgctttgggcctgcc
cactttgaatgcaggctaacaccaattggtgacccaacgatggtggtggaatggctccat
gatggaaagccactggaagctgccaacaggctccgtatgatcaatgaatttgggtattgc
agccttgattatggagttgcatattccagagacagtggtatcattacttgcagagctact
aacaaatacggaacagatcacacatctgctacccttattgtcaaagatgagaagagtctc
gtggaagaatctcaattgcctgaggggaggaaaggcttacagagaattgaagaattagag
cggatggctcatgaaggtgcccttacaagtgtgacaaccgatcaaaaagagaagcaaaag
ccagacattgtcttgttcccagagccagcaagagtacttgaaggggagaccgccagattc
cgttgccgagtgacaggctaccctcagcccaaagtcaactggtacctcaatgggcagctc
atccgcaaaagcaaaaggttcagagttcgctacgatggcattcattatctggacatcgtg
gactgcaaatcatatgatacaggtgaagtcaaggtcactgcagaaaaccctgaaggtgtg
atagagcataaagtgaagcttgagatccaacagagggaagattttaggtctgtgcttagg
cgagcccctgagccaaagcctgagtttcacgtacatgaacctggaaaacttcagttcgaa
gtacaaaaggtagacagacctgctgacaccaccgaaactaaggaaattgtgaggttgaaa
agggctgaaagaattacccatgaaaaagtgtctgaagagtcagaagagctgcgtagtaag
ttcaagcgcaggactgaggaaggctattatgaagccattactgctgtggagctcaagtct
cgtaagaaggatgaatcctatgaagaacttctaaggaagacaaaagatgaacttctccac
tggaccaaagagttaactgaagaggagaagaaagcccttgccgaagaaggcaaaatcact
attccaacttttaaacctgataaaattgaactaagtcctagtatggaggctcctaaaatc
tttgaaagaatccaaagccaaacagtgggccacggatcggatgtacacttccgggtcaga
gtggtggggaaaccagatcctgaatgtgagtggtacaaaaacggtgtaaagattgagcgc
tctgaccgaatctactggtactggcctgaagacaatgtctgtgagctggtcataagagat
gtgacggctgaggactctgccagcatcatggtaaaagccatcaatatagctggggaaacc
tcaagtcacgcattcttactcgtccaggccaagcaattgatcactttcacacaggaatta
caagatgttgttgctaaggaaaaagacaccatggcaacatttgaatgtgaaacctcagag
ccatttgtcaaagtgaaatggtataaggatggcgtggaggttcacacaggagataaatat
aggatgctctctgacaggaaagttcacttcctctccgtcctgacagttgacacatctgat
gctgaagactatagctgtgtacttgccgaagatgaaaacataaaaacaacggctaaactt
attgtcgaaggtgcagtcattgagtttgtgaaagaacttcaggacatagaagtttcagaa
tcattttcaggagagttagagtgcattataaccccggaaaatatagaaggcaaatggtat
cataatgatgtggagcttaaatccaatggcaagtacacaattacatctcgccgtggacgt
cagaacctcacagtcaaggatgtgaccaaagaggaccagggagaatacagctttgttgtc
gacgggaaaaagacaacctgtaaactaaagatgaaaccccgccccgttgctatcctacaa
ggactcagtgatcaaaaagtctgcgagggtgacattgtccagcttgaagttaaagtctcc
ttagagaaggtggaaggtgtctggatgaaggatggcgaagaagtgcagccgggcgacagg
gttcacattgtgatagacaagcagtcacacatgctgcttattgaagacatgactaaggag
gatgctggacattactccttcaccattcctgcccttggactgtcaaccagtgggcgcgtc
tctgtctacagtgttgatgtgataacacctctaaaagacattaacgtgcttgagggcacc
aaggctgtgctcgaatgtaaggtctcagtccctgatgtgacttctgttaagtggtactta
aatgatgaacaaatcaagcctgatgatcgcgtgcatgccattgtcaaaggcactaagcaa
cggcttgtgattaaccggacctatgcttcagacgaaggtccttacaagctgatggttggc
agagttgaaaccagctgtgacctttctgtagaaaaaattaaaattatcagaggtcttcat
gaccttacctgtacagagacccaaaatgtggtcttggaagttgaactgtcccactcagga
attgatgtcttgtggaattttaaggacaaggaaatctatcccagttctaaatataaaatt
gaagcccatggaaaaatatataagttgaccattctaaatatgatgaaagacgatgaaggg
gaatatatattttatgctggagaaaatatgacatctggaaaacttatcgtggcagggggt
gccatctccaagccactcacagatcagactgtagctgaatcccaggaagctgtgtttgaa
tgtgaagttgccaacccagattccgaaggagaatggttgaaggatgacaaacacctaccg
ctgagtaaaaacatcagaagtaaatctgatggccacaaaaggaggcttatcattgctgcc
accaaactagatgacattggagaatacacctacaaggtggccacttccaaaacatctgcc
aaacttaaagttgaagctgtcaaaattaagaagactctgaagaacctcacggtgacagag
acgcaagatgctgttttcactttggagctcacacaccctaatgtaaaaggtgtccagtgg
atcagaaatggggttgtgctggaatccaatgacaagtacactatctcagtcaaaggaaca
atttactctctgagaattaaaaactgtgccgttgtggatgaatctgtttatggcttcaag
cttggaaggctgggagccagtgccagactgcacgttgagaccgtcaaaatcattaagaag
ccaaaggatgtgactgccttggaaaatgccaccgttgcctttgaagttagcgtttcccac
gacacagtgccagtgaaatggttccacaagaacgtggagattaagccgagtgacaaacac
aggctggtctcagaaaggaaggtccacaaactgatgctgcagcatatttcccccttggac
gctggggaatatacagctgtcgtggggcaattggaatgcaaagcgaaactattcgtggag
acattacatattacaaaaaccatgaaaaacattgaggtacctgagaccaaaactgcctcc
tttgagtgtgaggtctcccacttcaatgtgccttccatgtggctaaagaatggggtggag
attgaaatgagtgaaaagttcaagatcgtggtgcagggaaaactccaccagctgatcatc
atgaacaccagcacagaggactcagcagaatacacatttgtctgtggcaatgaccaagtc
agcgccaccctgaaagtgacaccaatcatgattacatccatgctgaaggacatcaatgct
gaagaaaaagacaccattacctttgaggtcacagtgaactatgaaggcatctcttacaaa
tggttaaagaatggtgtggaaatcaaatcgactgacaggtgccagatgagaaccaaaaag
ctcacccactcactgaacatcaggaatgttcacgttggggacgctgcggggtacaccttt
gtggctggaaaagccacctcgacagccacgctttatgtggaagctcgtcatatagaattt
aggaaacacattaaagacattaaggttctcgagaagaagcgagccatgtttgaatgtgaa
gtttctgaacctgacatcactgtgcagtggatgaaagatggccaagagctacagcttgtg
gacagaataaagatacagaaggagaaatacgtccaccgccttctgatcccatccacccgg
atgtctgatgctgggaagtacacagtggtggctggaggcaacatgtccactgccagcctc
tttgtagagggcagagacgttcgcatccgaagcattaaaagggaggttcaggttattgag
aaacaacgtgctgtcgttgagtttgaggtcaatgaagatgatgtagatgcccactggtat
aaagacggcattgaaatcaatttccaacttcaagaacgacaccagtatgtggtggagagg
agaatccaccggatgtttatctctgagaccaggcatagcgatgctggtgaatacaccttt
gtggcaggaaggaacaggagttctgttaccctctacgtcaatgccccagaaccgccccaa
attctgcaggagctccagcctgttaccgtgcaatctggcaagcccgcccgcttctgtgct
gtgatatctggcagaccacagcccaaaatttcctggtacaaggaagagcagctgctttcc
actggtttcaagtgcaaattccttcacgatgggcaagagtacacacttctgctcatcgaa
gccttcccagaggacgcggccgtctatacctgtgaagccaagaatgactatggaattgtc
actacctcagcatcgctctctgtggaagttccagaagttgtgtctcctgatcaggaaatg
ccagtttatcctcctgccatcgtcaccccacttcaggacactgtcacttctgagggacgg
ccagcccactttcaatgcagagtttctggaacagatctaaaagtgtcttggtacagcaaa
gacaagaaaatcaagccatctcggttctttaaaatgactcagtttgaagacacttaccaa
ctggaaattgctgaagcttttccagaagatgaaggaatttatacttttgttgctagtaat
gctgtaggtcaagtatcaagcacagccactttgagactggaagctcctgaatcaatgttg
catgagcagattgagatggagatgaaagagttttctagttctcttctgtctgctgaggaa
gaaggacctcaaacctctagctctggccttcagttatctaatagaaatgaaacactggaa
cttttgtctgaacctccagttcattcaactaaattcgattccaaaaaggaaggcagtgtc
ccagttttcatcaaagaagtgtcaaatgctgaaataagcataggggatgtggctaagttg
tctgttactgtcactggtattcccaagcctcaaattcagtggttctttaatggagtaatg
ttaaccccttcagctgactacaaatttgtttttgacggtaatgatcacagcttgatcatt
ctgttcaccaaattagaggatgagggagagtatacatgtattgccagtaatgaatatgga
caggcaatatgtagtgcctatctgaaaataaattccaaaggagaggggctccaagaacca
gaatcagcagaagagaaatctctggaaaagctcgaaggtccttgtcctccttacttcctt
aaggagttaaaaccaattcactgtgcacaggggctccctgccatctttgagtacacggtg
cttggagagcctgcacccactgtttcgtggttcaaagaaaacaagcagctttgcaccaat
gtttattacactatcattcataatcctgatggttccgggacattcatcgtcaatgaccct
cagaaagaagatagtggtttctatgtctgtaaagcggagaatgtgtggggtgaatccacc
tgtgccgcagagctgctcgtgcttctggaagacacacatatgactgatgccccctgtaaa
gcaacgtccacaccagaggctcctgaagattttccccagacgtcgttaacggtccctgca
gttgaggcacttgactcagagcaggagactgcagcttttgtaaaggacaccattttgaaa
gctgctttaattgcagaaggaaaacagcagctttcttacgagcatattgttaaaaccaat
gaactgagcagtcaagttactttcatagctgagcaactgcaatccacagtcatgttacag
caggatatgcccactcctgaaagcatcagtgaacttctttccatcagtgacactattcat
gtccagcctatcaaggaaccacctcccaatgtacagctgcagattgtccagtcccaggac
accttccccaaagaagatattctaatgtatcaagagcctgaattacaggtggttctatca
gatactgaaaaaatcttcccaagtgccatgtccatagaggaaattagttcattaacagtt
gagtctctgcaaactttattagctgaacctgaagggagttatccacagtcatcaatagaa
gaaacgccagcccattcatatccaacctctgtggctgaggaagtacttttaccaaaagaa
aaggtagtatccacagtggacgaagagcaaagagtgatccttcaagagcaagaggcacaa
agtgctctcatcctgaatcagagcttagctgagggacacgtggaaagtttccagggtcct
gacatcatgatctcccgggtcccttcagaacacacgtgcacagaaggtgaaatcttaatg
gaaagtgtggatcaactggacagtgcaaagcaagatttcgcagccagcattgaggaaggc
aagtccttaaggtttccgttggcaggtgaggaaaagcaggtactgctcaaggaagagcgt
cttgacagcttggcaatgcccccgaaccaaaccactaagtataaaaaagagcccatggca
ataaatggtgtgcaggaggtgcagggaagtgacctgctttctaaggaaagtttgctttct
gctattcctgaagagcagcggttaaacctgaaaactcagatccgcagggctttgcaagca
gcagtggccagcgagcagctgagtcttttctctgaatggttaagaaacattgaacaggta
gaggtcaaggccatagacttcacccaagagcccaaccgcattatgtgcacctactttatt
acctcagtgaagtctctaacagaagaattagccatcactattgaaggcattgatcctcaa
atggctaacttgaaaactgaacttaaggaggctttgtgctctataatatgtgaggaaatg
aacatcttaacagctgaggaacctggaattcagaaaggagccacaacagacttgcaggaa
gaaatggattctttttctaatccacagaaggttgaagcaatcaccgaaccagaggttgaa
tctaaatatcttgtcttaaaggaagagataagttattttaaggtggaaagtcaggtcaaa
gctgtgggtgccacaactgcttccgctgctgtctctgatgaaaaactggatgagatacca
aaaccatcagaggaaaaagagaaatcccctgaaggtggtactgagaaggctggtacagta
gagatacgggaggctgagggtagctcactcagagagggtggtcctgacgtacagacgccc
ttggtggacacgattgccaaggaaggtgacaccgtaagactcgcgtcatccataacaaat
gccaaagaggtgaattggtattttgagagtaaactggtgccttcagatgaaaagttcaag
tgtttacaagatcaaaatacatatatgctagtgatcgacaaagtaaatagagaagaacat
caaggggaatatacgtgtgaggccttgaatgatgacggaaaaacagcaacttcagcaaaa
ctcactgtagtcaaaagagctgccccagtgatcaggaggagaattgagcccctggaagta
gccctgggccacctcgccaaattcacctgtgagatccacagcgcccccagtgtccgcttc
cagtggttcaaagctggccgagaaatctatgagagtgacaagagttctattcggtctgca
aattatgtctccaccctggaaatcctgagaacccaggctgttgactgtggcgagtacacc
tgcaaagcttccaacgagtatggcagcgtcagctgcacagccacactgactgtgacagag
gcatatccaccagcctttctctccagacctaagtccataacaacttttgtgggtaaggca
gccaagttcctctgcacagtgacagggtctccagtgattgaaaccatttggcagaaagac
ggcgtggccctctcaccttcccctaactgcaggatttcagatgcaaacaacaaacacatt
ttagaactctcaaatcttacaattcaagatagaggagtttactcctgtaaggcttctaac
aagtttggagccgatacttgccaagctgagttggtcgtaatcgacaaaccacatttcatt
aaagagctagagcctgtgcaatcagctgtcaataagaaggtccaccttgagtgccaagca
gatgaagacagaaaagtcacagttacatggagtaaaaacgggcaaaagctcccctctggg
aaagattataagatctgttttgaagataaaatagcatcccttgagatccctctggccaaa
ctaaaagatacaggaacgtatgtttgcacagcttccaatgaggctggaagcagctcctct
tcagcgacagtaactatcagagagccaccatcctttgtgaagaaggtggatccctcttat
ttaatgatcccaggtgaatcagcacgcctccactgcaagctgaaaggctcacctgtgatc
caggttacttggtttaaaaataacaaagaacttactgagagtaacacaatcagaatgtct
tttgtcaattctgaggctgtccttgatattacggatgtaaaggttgaagacagtgggaat
tactcgtgtgaagcagtgaatgacgttggcagcgacagttgcagtgctgaaatggttatc
aaagaacctccttctttcatcaaaactctcgagcctgcagatatagtgagaggaacaaat
gccctccttcactgtgaaatctcaggcactggaccatttgaaattcgctggttcaaggat
aagaagcaaattcgaagtagtaaaaagtacaggctgttttctcagaaatctgtcgtgtcc
ctggagatcttttcgtttaatagcgcggacgttggtgaatatgagtgtgtggttgctaat
gaagttgggaagtgtggctgccttgcaacccacttactaaaagaaccaccgatctttgta
aagaaagtagatgattttactgcactagcaggacaaacggttaccttacaagctgctgtg
aaagggtcagaacccatttctgtcacatggatgaaaggacagaagatcattaaagaagat
ggaaaaatcaaaatgagctttgccaatggtgttgcggtcttgataatccctgatgtgcag
attagctttgctgacaaatacacatgcctggctgaaaatgaagctggaagccaaacgtct
gttggggaactaatagttaaagaacctgccaaaatcgttgagagggcagaactgatccag
gtgacggcaggagacccagccacgctggagtatacagtcacgggtaccccagagctcaag
cccaaatggtacaaagacgggagacctttgattggcagtaaaaagtatcgaataagtttt
aaaaacaatgttgcccaactcaagttttattccgccgaactgcatgatagcggccaatac
acatttgagatttccaacgaagtgggcagcagctcctgtgagacaactttcactgtctta
gatcgagacattgctccattttttaccaaacccctacgcaacgtggacagtgtggttagt
gggacctgcaggctggactgcaaaatcgctggctccctccccatgagggtgtcctggttt
aaggatggtaaagaaatagcttcctctgacagatacagaatagcatttgtggaaggcaca
gcctctctggagataagcagaatagacatgaatgatgcagggaatttcacctgtcgagcc
acaaattccatgggaagcaaagactgcagcggagccctgattgtgcaagaaccacccagt
tttgtaactaaaccggcatcaaaggatgttctgcccggctcgaccatctgcctgaagagc
accttccaagggtctacccctctcacaatcagatggtttaagggtgacaaagagctggtt
tccagtggaaactgctatatcaccaaagaagctttagaaagttccctggaatactatgta
gtaaaaacctccgactcaggcacatatacctgtaaagtcagcaacgtggctggagccgtg
gagtgcagtgcaaagttatttgtaaaagaacctgccacatttgttgaaaagttagagcca
tcacagctgttaaaaaagggagacgccacccagctagcctgcaaagtaacgggcacccct
ccaattaaaataacgtggtttgcaaatgacagagaaattaaggagagcagcaaacacaaa
atgtcttttgtggagtccaccgcggttctaacacttaaagatgttgccattgatgacagc
ggtgaatatatgtgtgaggctcaaaatgaggctggcagtgaccactgtggtagcatttta
atagtcaaagagtcaccttactttaccaaggaatttaagcccattgaagtgttgaaggag
tatgatgtcacgttgctggctgaggtggcaggcacacctccctttgagatcacttggttc
aaagacaacacaacactgcgaagtggtagaaagtataaaaccttcattcaggatcagctg
gttagcctgcagatcctgaggtttgtagctgcggacgcaggtgaataccagtgtcgggtg
accaatgaggtgggcagcagtgcctgcagtgccaaggtgaccttaagagaacccccagct
tttgtaaagaaaatcgagagcaccagctcccttagaggaggtaccgctgccttccaggcc
actctgaagggctccttgccaatcacggtgacttggctgaaagacaacgatgaaatcact
gaagatgataacataagaatgacctttgagaacaatgtggccagtctgtacctcagtggc
attgaaatcaagcatgatgggaaatatgtctgtcaggccaaaaatgatgcgggagtacag
agatgttccgcattactctcagtaaaagaacctgcaacaatcattgaggaggctgtgtct
atagatgtcacccaaagagacccagccactttgcaggttaaattttcggggactaaggag
attacagccaaatggtttaaagatggccaagaactgaccctgggccaaaaatataaaatc
agtatcactgacacggtctctatactgaagattatttctacagaaaagagagatagtgga
gaatatactttcgaagtccaaaatgatgtcgggaggagcagctgcaaggctagcattaat
gtattagatcttatcatacctccctcattcaccaaaaggttgaagaaaatggacagcatt
aaagggtcttttattgacttagaatgtatagtggctgggtcacatcccatgagcatccag
tggttcaaagacgaccaagaaataacagctagtgaaaaatacaaattctcttttcatgac
aatactgccttcttggaaatcagtcagctggaaggtacagatagtggaacctacacttgt
tctgccactaatcaggcaggacacagccagtgcagcggccatctgacagtcaaagaaccc
ccttacttcctggaaaagccacagtcacaagatgtcaatcccaatacaagggttcaatta
aaggcgcttgtgggtggcactgcacccatgacaataaaatggtttaaagataacaaagag
ttgcactcgggagcagctcgctcagtttggaaggatgacacctccaccattctagagctc
ttttcagccaaagctgccgatttggggacgtacatttgccagctgagcaacgatgttggc
atagcaaccagtaaagccactctctttgtcaaagaacctcctcacttcattaagaagccc
agtccagtcctagtgctgaggaacggacaatccacgacatttgaatgccagataacaggc
actcctgaaatcagggtttcttggtatctggacgggaatgaaataacagccattgagaaa
catggcatttccttcactggtggtttagccactttccaaatttctggtgccagggtagaa
cacagtgggacttatgtctgtgaagctcgtaacgacgctggcacggcaagctgcagcatt
gagttaaaagtgaaagaacctcccaccattattagggagctgaaacccgcggaagtagtc
aaagatagtgacgtggagctggagtgtgaagttatgggaacatctccatttgaagtcact
tggctgaagaataacaaggaaattcgaagcagcaaaaagtatacgctgactgacagagtg
tcagtgtttaatctcaatatcaacaagtgtgacccctcagacactggtgaataccagtgc
atcgtatccaacgaaggcggcagctgttcttgtagtgctagagtctctctgaaagagcca
ccctcgttcactaagaagatagaaaacgtcactactgtcttgaaaagttctgccaccttt
cagagcactgtggtgggctctcctcccatttttataacctggctcaaggatgatcagatt
ctggatgaagatgataatgttcacatctcctttgtgaacaatgtggccacagttcaaatc
agatctgtggataatggacacagtgggaggtacacgtgtcaagccaagaacgagtcagga
gttgagaggtgttatgctttccttttagtacaagaacccgctcagatcctagagaaacct
aagtctgttgatgtcactgaaaaagaccccgtgaccttggagtgtcttgtggccggaaca
ccagaactcatagtgaagtggtttaaagatgggaaacaaatgatgcccagtagatatttt
tcaatgagttttgaaaataacgtggccagttttaggattcagtcagtaatgaagcaagat
agcggggcgtatactttcaaggtggaaaatgactttggaagcagtagctgtgacacctac
ctgagagtgctagatcaaaatattcctccatcattcaccaaaaaattaagcaaaatggat
aaagttctaggctcttccatccatatggagtgcaaggtttctggctcactccctattagt
gctcagtggtttaaggatggaaaagagataactacaagtgcaaaatacaggctcgtctgt
catgaaaacgctgtgtcgctggacgttagtaatctggaattagaagatactgcgaattac
acatgcaaagtctcaaacgtagcagggagcgaggcatgcagtggcatcttaactgtaaaa
gaaccaccaagtttcctagtgaaacctgggcgacaacaagccatacctgattctacagtg
gaatttaaagctatactaaaaggaacaccaccgtttaaagtaaagtggtttaaggatgat
gtggagcttgcctctggacctaaatatttcattggcttagaaggctcaactaccttctta
aatctctattcagtggatgcttccaagactggacaatatacttgccaagttaccaacgat
gttggtagcgactcttgtaccacagtgttgcttgtgacagaaccaccaaagtttgcaaag
aaactagaagcaaccaaaatagtgaaagcaggtgactcagcacgacttgaatgcaagata
actggatccccagacatcagagttgtgtggtacagaaatgaacatgaactcccagccagt
gataaatatagaatggctttcattgattcactggccgtcatacagatgaatagtcttggt
actgaggacagtggggatttcatttgtgaggctcagaacgctgctggcagcacaagctgc
agtaccaaggttatagtaaaagaaccacctgtttttagcagcttccctcctgtggtagaa
acccttaaggatgctgaagttagtcttgaatgtgaacttttaggaacaccaccatttgag
gtggtttggtacaaagataagcgacaactccgaagtagcaagaaatacaagatcgcatcc
aaaaatttccatgcaagtattcacattctcagtgtcaacacttcagatattggtgaatac
cactgcaaagtacagaatgaagtaggaagtgatacctgcatttgtactgtaaaattaaaa
gaaccaccaagatttgtctccaaactgaacagcctcacggttgtagctggtgagcccgct
gagttacaagcatctatagaaggcacccagcctatttctgtccagtggcttaaagaaaag
gaagaagtgattagagaaagtgaaaacatcagaattacatttgtggaaaatgttgcaact
ctgcagtttgcaaaagcagagccagctaatgctgggaagtatatctgccaaatcaagaat
gatggtggaatgagggagaacatggccacgttgactgttttagagcctgcggtcattgtc
gagaaggcaagttcgatggcagtgactgcaggagaaacgtgcactctggagtgtaaggtg
gctggcactcctgaactctcagtcgaatggtacaaggatggaaagctgttgaccagcagc
caaaaacacaaatttagcttctacaacaaaatctcttccttaaagattctctccgttgaa
aagcaagatgcaggcacatacactttccaggttcaaaataatgtcggaaaaagcagctgc
acggctgtggttgatgtttcagaccgaatggttcctccctctttcacacgaagtctgaaa
gatacagttggggtcctgggtacatcttgcatcttggagtgcaaagtagctggatcatcg
cctatctctgttgcctggtttcatgagaaaaccaagattgtcagtggagcaaagtaccaa
actacgttttcagataatgtctgcgcgttgcagctgaattctctggactcatcggacatg
ggcaattacacatgcatggctgctaatgtcgctgggtctgatgaatgccgtgctgtgttg
gctgtacaagaaccaccctcttttgtgaaggaacctgaacctttggaagtactaccaggc
aaaaacatcaccttcacaagtgtcattagaggaacacctccgttcaaggttggctggttc
agaggtgccagagaactggtgaaaggagacagatgtaacatctattttgaagacaccgtg
gcagaactggaattatttaatgtcgacacatctcagagtggggaatatacctgtgtggtt
tctaacaatgccggccaaacatcctgcactacccgtctctttgtaaaagaaccagctgta
tttgtgaagaaattaagtggtcactctgtagagccagggaagtccatcattctggagagc
acctacactggaacactccccatttcagttacctggaaaaaggctggtgtgaacattaca
ccatctgaaaaatgcaacatagtcacaacagagaagacctgcatcctggaaattctgaat
agcacaaaaggagatgcaggacagtattcttgcgagattgaaaacgaggcaggaagggat
gtttgtgaagctctggtatctacattagaaccaccttattttgttaccgaactgaagcct
ctggaggcatcagttggagattcggtttctttacaatgccaagttgctgggacaccagaa
gttacagtgtcttggtacaaaggcgataccaagttacggtcaactcctgaatacaggacc
tattttacaaacaatgtggccacacttgtttttaataaagtgaacatcaatgacagtgga
gaatacacatgtaaagcagaaaacagtatagggactgcttcttctaaggctgtcttcaga
attcaagagtcccagctcccaccttcctttgcaaggcaattaaaggataccgaacaaact
gttgggttaccagttaccctcacttgtcgactgaatggctccgcacccatccaagtgtgc
tggtatagagatggggtacttttacgagatgatgaaaatctacagacatcatttgtagat
aatgtggcaactttaaaaattttgcaaacagacttgagtcactctggccaatactcctgc
tcagcttctaattcacttggaacagcgtcttccagtgctagactgacagcaagagaacct
aagaagtcccccttctttgacatcaagcctgtatctatagatattattgctggggaaagt
gctgactttgagtgtcatgttactggtgctcaaccaatgcgaattacttggtcaaaagat
aacaaggaaatccgtcctggaggaaactacacaattacatgtgtgggaaacactccccat
ttgagaattcttaaagtaggcaaaggagactctggtcagtatacttgccaagcaaccaac
gatgttggcaaagacatgtgctcagctcaactcagtgtaaaagaacctccaaagtttgtt
aagaaattagaagcttcaaaagttgcaaagcagggagaatcccccaaactggaatgtaaa
ataagcggttccccggaaatcaaagttttgtggttccgaaatgacggtgaacttcatgaa
agttggaaatacaacatgtcattcatggattctgtggcatcgctcaccatcaatgaagcc
agcacagaggatagtggggactatatctgtgaagcccataacggtgttggggacgccagc
tgtagcacagccctgacgattaaagcacctcctgttttcacccagaagccttctccagta
ggagcccttaaaggttctgatgttatcttccaatgtgaaatttcgggaacccccccattt
gaagtggtgtgggttaaagatcgaaagcaagttcggagcagcaagaaatttaaaatcact
tcgaaaaattttgatacaagtctccacatccttaatctggaagctgccgatgtaggagaa
tatcactgcaaagctgctaatgaggtgggaagtgacacatgtgtttgcactgtcaagttc
aaagaacccccacggtttgtgaagaagctaagtgacacctcaaccctcgctggggatgcc
gttgagttacgggccatagtggaaggcttccagcccattgctgtcgtctggctgaaagat
aaaggtgacattatcagagagagtgaaaacactaggatttcgttcattgataacattgca
acactccaactcggaagcccagaagcatctaactctggaaaatatgtgtgccagatcaga
aacgatgccggaatgagagagtgttcagcagtcttgactgtcctagaaccagccagaatc
atagagaaaccagaacccatgactgtcactactggagatccttttgcattagagtgtgca
gtggctgggacaccagaactttcagccaagtggttcaaagatgggagagaattatctgca
gacagcaaacatcacatcacattcatcaacaaagtggcttcacttaaaatcccttgtgca
gaaatgagtgacaaggggttatatagctttgaagtgaaaaacaatgttggtaaaagtaac
tgcactgtgtctgtccatgtttcggatcgagtcgtgcctccttccttcatccgcaagttg
aaggacaccaacgccatcctgggggcctcggcagttttggagtgcagagtctccggctcc
gcgcccatctccgtgggctggtttcaggatggaaatgagatcgttagtgggcctaaatgc
cagtccagcttttcggaaaacgtctgtactttgaatctgagcttcttggagccctctgat
acaggcacatacacgtgcgtggccaccaacgtggctgggtcagacgaatgctcggccgtc
ctgactgtccaagaaccaccatcttttgaacaaacccctgattctttggaagttctccct
ggaatgagcctcacattcaccagtgtcattagaggcaccccgcctttcaaggtcaaatgg
tttaaaggcagcagggaactggtgtcaggggagtcatgcagcatctctctggaagatttt
gtcacagaactggaattgtttgaggtggagccattgcaaagcggggaatattcttgcctc
gtggctaacaacgctggcagtgcttcctgtaccacgcatctttttgtgaaagaaccagcc
acctttgtgaaaagattggctgatttcagcgtcgagacaggaaaccccatcgttctcgag
gccacgtttaccggcacacctcccatctcggtgagctggatgaagaatgagttccccctt
acacaatctcggaattgcagcattaccatgacggaaaaatctacgatcctagaaattctt
gatagcacaatagaggattatgcacaatacagttgcctcatagaaaatgaggccggtcaa
gatatttgtgaagcgctggtatctgtctcagaaccaccttattttattgagcctctggaa
cacatggaagcagccgtcggagaacctgtaactttacagtgtaaagtggatggaacccca
gaaattagaatttcttggtataaagaacacacaaagctacgatcggctcctgcgtataaa
atgcaattcagaaataatgttgcctccttagtaatcaacaaagtggatcccagtgacgtg
ggagaatacacatgcaaggctgaaaacagcgtgggggcagtggcttcctcagctgtgctc
gttatcaaagagcgcaaacttccaccttcctttgcaagaaaactgaaggatgttcaggag
acccttggcttcccagttgcatttgaatgtcgcatcaatggctcagaacctcttcaagtg
tcttggtacaaagatggggtgcttttgaaagacgatgctaatttgcaaacatcttttgtt
cataatgtagcaactcttcagattttgcaaactgaccagagccatgttggtcagtacaat
tgctctgcttctaatcctcttgggacagcttcatccagtgcgaagctcatcctcttagac
catgaagtgcctcctttctttgatctaaagcctgtgtcagtagatcttgctctcggagaa
agtggttcttttaaatgtcacataactggaactgcaccaatcaagatcacttgggccaaa
gataaccgagagattcgccctggaggcaactacaagatgactttggttgaaaatactgcc
actctgacggttctcaaagtaggcaaagtcgatgctgggcaatacacctgctatgcaagc
aacgtcgctggaaaagactcttgttctgctcatctgggtgtacaagaaccccccaggttc
attaagaagctagaaccttcaagaatcatgaaacaagatgaatctacaagatatgaatgt
aaagtaggagggtctccagaaatcaaagttttatggtataaggacgagactgaaattcaa
gagagcagtaaattcagaatgtcattccatgactcggtggcggtattggaaatgcacgcg
ctcagtgtagaagacagcggagactacacgtgcgaggcctgcaacgcagcgggcagagca
agcagcagcaccaccttaaaagttaaagaaccacccgttttccgcaaaaagcctcgtccc
gttgagacactggaaggagctgatgttcaccttgaatgtgagcttcagggcacccccccg
tttcaagtttcttggcataaagacaagagagaacttaggagtggcaagaagtacaagata
atgtctgagaacttcctgacgagtatttacatcctgagcgtcagtgctgcagacgttggg
gaatatcagtgtaaagccacgaacgacgtggggggagacacctgtgttggttccatcact
ctgaaagcaccaccaagatttgtgaagaagcccagtgacatttctgccatcgttggtgaa
gaagttcagcttcaggctgctattgaaggcactgagcccatttccgtggtgtggttcaaa
gacaagggggagatggtcagagaaagtgacaatatatggatctcttattcagaaaacatt
gcaaccctacagttttcaagagtggaaacagccaatgccgggaaatacacctgtcagatc
aaaaatgatgccggaatgcaagagtgcttcgccacagtgtccatcctcgagcctgcagca
attgtcgaaaagccagaatccataaaagtgaccacgggagacacctgtaccttggagtgc
atggtcactggcacacccgaactcactactaagtggtttaaggatgccaaagagctgaca
agtgatagcaaatacaaaataagcttcttcaacaaaatatctggccttaagattattaac
gtggcccccagtgacagtggggtgtacagttttgaggtgcaaaaccctgtgggcaaagac
agctgcacagcctcagttcatgtttcagaccgaattgtgcctccatcattcacaagaaaa
ttgaaagagacaaatggtctgtctggctcctcagtggtaatggagtgtaaagtctatgga
tcacctccaatctccgtctcctggttccatgaaggaaacgagatcagcagtggaaggaag
taccagaccaccctgacggataacacttgtgccttaactgtgaacatgctggaagactca
gacgccggcgactacacgtgtatagctactaacgtggctggctctgatgagtgtggtgct
cctttgactgtgagagaaccaccatcttttgttcagaaacctgatcccatggatgtttta
actggaacaaatgtaactttcacaagccttgtaaaaggaacacccccgttcagtgtcagc
tggttcaagggtagcagtgaactagtaccaggggacagatgtaatgtgtctttggaggat
tcagttgctgaactggagctgtttgatgtagatacatcacaaagtggagaatatacctgc
atcgttagtaatgaagctggcaaagcttcttgtacaacacatctatatgtaaaagcccca
gccaaatttgtgaagaagctcaatgattacagcctagagaaaggaaaacccctgatccta
gagggcacgtatactggaactcttcctatttcagttacatggaagaaaaatggcacaaat
ataactccttctcagaggtgtcatataaccacaactgaaaaatctgcaatcctggaaatt
ccaagcagcacagtggaggatgcaggacagtacaactgttacattgaaaacgcttccggg
aaagactcctgttcagcacaaatcctgatactagaaccaccatattttgtcaagcagttg
gagcctgtgaaggtgaccattggagattctgcctctttgcaatgccaacttgctgggacc
cctgaaattggggtgtcctggtataaaggagatacgaaattgagacccacgactacctac
aaaatgcattttaggaacaatgttgctacactggttttcaaccaggttgatagtaatgac
agtggagaatatatctgcagggctgaaaacagtgtgggagaagtttcttcatcaactttc
ctgactgttcaagaggaaaaacttccaccatcgttttctcgacagttgagagatgttcaa
gaaacggtcaggctgccagttgtttttgagtgtgctgtcagtggatcagaacctatcttg
gtgtcttggtttaaagatggcaagccgttgaaagacagccccaatgtacaaacatcattt
ttagataatgtagccactctcaatatttttcaaacagatcggagttttgcaggccagtat
tcttgcacagctacaaatcctataggttctgcttcttccagtgccagactcattctcaca
gaggggaagaacccacccttctttgacatccctcttgcccctgtggttgctgtggtggga
gacagtgcggactttgagtgccatgtgactgggacacaaccgataaaggtcacctgggcc
aaagacaacagagagatccaaagtggcggaaactatcagattagttatctggaaaacagt
gcccacctgacaatcctgaaagtagacaaaggagactctggacagtatacgtgctatgct
gtcaacgaagtgggagaggactcctgcgtggctcagctcaatataaaagagcggctaatt
ccaccaagtttcactaaaaaactctcggagacagtagaagaaacagaaaggaactctttc
aaactcgagggccgtgttgctggttcccagcctatttctgtcgcttggtacaaaaataac
atagagatccatccaacgtctaactgtgaaatcacattcaagaacaacacacttctgctg
caagtcaagaaggcaggcatggacgacgctggtttgtacacgtgcaaagtgtggaatgat
gcaggctctgctctgtgtacatcttcagtcgtcatcaaagcacctaagaagccacctgtg
tttgatcagcaccctactccagtaacagttaatgaaggagaattcgtgcagcttagctgc
cacgtccagggatcagaaccgatcaggatccagtggttgaaggctggcagggaaataaag
ccctcagacagatgcagcttcagctttgctaatgggactgctgtgctggaactcaaggat
gtgtctaaagcagatgcgggagattatgtgtgtaaagcttcaaatgtggctggaagtgac
acttgcaaatcaaaagtgaccattaaagacaaaccagctgccgtcccagcagctaagaaa
gcagcagtagatggaaaactcttcttcatatcagaacctcagagtatgagagttgtagaa
aaaaccactgcaacattcattgcgaaagttggaggtgatccagttccagatgttaagtgg
acaaaagggaagtggagacaactgagccaaggaggtcgaatttttatccaccagaaagat
ggtgaagcaaagctggagatcagaggcaccacaaaaaccgattctggattataccgatgt
gttgcatttaacaagcatggtgaaattgaaagtaatgttaatctacaggtggatgaaagg
aagcaacaagagaaaattgaaggagatcttagagcaatgctgaaaaagactccagcctta
aagaaaggagctggggaagaagaggaaattgatatcatggaacttctcaaaaatattgat
ccaaaagaatatgaaaaatatgcccgcatgtatggaatcactgacttccggggtcttctt
caagcatttgaaatgctaaagcaaagtcaagtagaagagacacatagattggaaattgag
gaaatagagaagtcagagaaggaagaaaaggaatttgaggaacttgtatcatttattcag
caaaggctgtcacagacagagcctgtcactttgatcaaggacattgaaaatcagacagtt
ttgaaagataatgatggtgtgtttgaaattgacattaagattaattatccagaaatcaag
ctttcatggtacaaagggactgaaaaactggaacccagtgataaatttgaaataagcatt
gatggtgatcaacataccctcagagtcaaaaactgtcaacttaaagatcagggcaattat
agattggtgtgtggtccacacatcgctagtgctaaactaactgtaattgagcctgcctgg
gaacggcatcttcaggatgttactttgaaagaaggccagacttgtaccatgacttgccag
ttttctgtgccaaatgtaaaatccgaatggttcagaaatggcagaatccttaaaccccaa
ggtagatataaaacagaagtggagcacaaagtccataagatgatcattgcagatgttcga
gcagaggaccagggtcagtacacctgcaaatacaaagaccttgaaacttcggcagagctc
agaattgaagctgaaccaattcagtttacgaagcgcatacagaacattgtggtgagtgag
catcagtctgccaccttcgagtgcgaagtgtccttcgatgatgccatcgtaacatggtac
aaaggaccaacagaactgaccgagagccagaaatacaacttcaggaatgacggtcgctgc
cattatatgaccatccacaacgtgaccccagatgacgaaggtgtctattcagtaattgct
cgactggagcccagaggtgaagcaagaagcacagcagagctgtacttaacaaccaaagaa
atcaaacttgagatgaagcctcctgatattcctgactccagagttccaattccaaccatg
cctatcagagcagtacctccagaagaaattcctcgtacggcggttcctcccatccccctg
ttgctaccatcacctgaagaaaagaaaccaccagcaaaacgtattgaagtgaccaaaaaa
gctgtgaagaaagatgctaaaaaagttgtcacaaagcccaaagaagaggcaccaccacct
aaagttccagaggttgccaagaagcccccacctcctactgccttaattccagcagaagct
cctgaagtgattgatgtatcctccaaggctgaagaagtgaaaataatgaccataaccaga
aagaaagaggttcagaaagaaaaagaagctgtgtatgagaaaaagcaagcagtctacgag
gagaagaaagtttacatagaatctttggaagaaccttatgacgaactagaggtagaacca
tacacggagccatatgaagagccttactatgaggaaccagatgaagagtatgaagagacc
caggtagaagctaaaagggaagttcatgaggaatgggaagaagattttgaagaagggcaa
gaatactatgaaagggaagaaggttatgaggaaggggaggaagaatgggaggagacttac
caagaaagagaagtcatccaagttcaaaaggaggcttatgaagaatcacgtgagaggaaa
attccagcaaaagtaccagaaaagaaagaagtaccacctcctaaagttgtaaagaagccc
gtagttgaaaaaattgaaaagacttctcgaagaatggaagaagttcaagtcaccaaagta
cccgaagtttcaaagaagattgttccacaaaaaccttctcggactccagtgcaggaagaa
gttattgaagtgaaagtacccgctgtacatacaaagaagatggttatttcagaagaaaag
atgttctttgcttctcacacagaggaggaagaagtgtcagtcacagtccctgaggtacaa
aagaaaactgttaccgaagagaaaattcacgttgctgtttccaaaaagattgagcctcca
cctaaagtccctgagccacccaagaaaccagtctcagaggaagtagtccctgttccccac
cttcctaaaaaggtggagcccctaccagccaaagttcctgaagttcccaagaaacctgta
ccagaggagaaaaagccagttcctgtgcctaagaaggaacctgccgctccccccaaagtc
ccagaggtgctcaggaaacctgtccctgaagaaaagattcctgttcctgttgcaaagaaa
aaggaagctccaccagctaaagttcctgaagtacagaagagggttgttgcagaagaaaaa
ataatcatcgtcactgaaagggaggaatctccaccaccagcagtgccagaagtaccaaag
aagaaagttcccgaagaaaaaagacctgttccttggaaagaggaagaagttccaccacca
aaagtaccagctctgcctaagaaacctgtccctgaggagaaagttcccgtgcctgttctt
gctgctaagaaagcccctcctccccgagctgaagtttctaagacaactgtcgtagaagaa
aaaagatttgttggtgaagaaaaaccatccgttgcagtttctcaaagagtggaggtcgtg
cggcacgaagtatccgcagaggaggaatggagttattcagaagaagaggaaagagtatgt
gtttcagtttatagagaagaggaaagagaggaggaagaagtggaggttacagattatgaa
gtgatggaagagcctgaggaatatgttgtagaagaagagctgcactttatttctgagaaa
gcggacgctgaaccagccgaagtgcctaagaagaaaattgtacccaaaccgaaaactcct
gctaaaatagaggagcctccaccagctaaagttcctgaagtacctaagacaattgtgcca
gaaaagagaattcctgctgcagttcccaaaaaggaaaaggtgccaccaaccaaagtgcca
gaagagccaaagaaaccagttcctgaaaaaagggctcctcccaaagtggctaagatagaa
gaacctcctcccaccaaagtgactgagaggcacatgcaaattgcccaggaagaaaaagtt
cacgttgctgtaactaaaaaagtggagcctccaagaccaagagtgcctgaggaacccaag
agagctgttccagaagaaaaagttccaaaactcaagcctagaaaagaggaggagccacca
gtaaaagtgactgaactcaggaaaagagctgtcaaagaacaaaaggtatccattgaagtt
ccaaaaagagaacctccagcagctaaagaagtaactgtaacagcagagaaagaatgggct
tacacccaggaagaagaaactgtttcagtacaatgggaagaggaatatgaagaacatgat
tatgaagaatttgaggagtatgaaccaacagaagaatatgatcaatatgaagagtatgag
gagcatgaattcgaacattacgaagagtataaagaacatgaagaatatgtcacagagcct
gagaagcccaccccagtaaagcctgtccaggaagaaccggttcccacaaaaccaaagatc
ccaccagctaaagtgccgaagaaagtggtccctgaagaaaaagtaccagtgcccattcct
aagaaactcaaacctccaccgcccaaagtgcctgaagaagcaaagaaagttgttgaggaa
aaaatacacatttcaattaccaaacgtgaaaaagagcaggtgactgaaccagctgataaa
gtgcccatgaagcccaagagggttgtcacagaagaaaaagtacctgttcctaaaaaagaa
gtagcagcacctgttagagtgcctgaagtacctaaaagacaaccagaagagattgccttt
gaagaggaagctgtaacccaagtagaggaatattttgaagaagaagagtacattcatgaa
aaagaagaactcataactgaagaagaaggggagctcataactgaagaagtggtaccagtg
gtacccgtcaaagtgcctgaggtacccaagaaacctgttccagaagagaagaaacctgtt
cctgtgcccaaaaagaaggaagccccaccagcaaaagtgcctgagattcctaagaagcca
gaggagaaagttcctgtgcccattcctaagaaagagaaggctccaccagctaaagttcct
gaagtacccaagaaacctgtaccagaggagaaagtaccagtaccagttcctgaaaaggtg
gaagctccacctgccaaagtgccagaagtgcccaagaagcctgtgcctgagaagaaggtg
ctggttcctgctcctaagaaagtagaggttccatctgcaaaagtgctagtggtgcccaag
aaggtcatcacagaagaaaaggagccaacacctgttccgaaaaaagtggaagctccatca
cccaaagtgccaaagaaacgtgagccagttccagttccagttcgagttcctgtagctcta
cttcgggaagagaaagttgtatttgaagaagaaattgttcttgaagaggaagttctacct
gaggaggaggaagttccaccagcagaagaggaaattccacctgaggaagaggaagttcca
cctgaggaagaggaatttccaccagaggaagaggaagttccaccagaggaagaggaaatt
ctatcagaggaagaggaagttgctcctgaagaagaggaaattcctcctggggaggaagaa
tttgtacctgaagaagaagaagttcttccagaaattaaagctaaggtgccagtacctgca
cgagtgcctgaagtgccaaagaaacctgtaccagagaagaaagtccctgttccagctcct
aaaaaagtggaacctccaccacccaaagtgcctgaggttaagaagaaggtgccagagaag
aaagtgatcactcctaagaaagaggaggctcctcctgccacagttcctgaggtgcctaag
aaagtggaagaaagacgaatcattgttcctaaagaagaggaagttccaccagttgaagtg
tttgaggagcctgaagagcctattccagaagaagagatcccagaggaaccacctcgcata
gaggaggttgaggaggtggcgccacctagagtgcctgaagtggttaagaaagcagtacct
gaagcacctactcctgttcctaagaaagtggaggcaccaccagctaaagtgccaaagaag
gttcctgaagaaaaagtacctgttcctgttcagaaaaaagaggcccctcctgccaaagtg
cctgaagttcaaaagaaagtcccagaaaagaaagtccctgaaaagaaagtccctgtgcct
aaaagagaagctgttcccccagctaaagggagagctgttcttgaagaaaaaatatcagtt
gctgtccataaaaaggaagtagtaaaagaaagagcagaattagaaatagtggaagcacaa
gtggaagaagctcgtgaagaagagttccatgaggttgaagaatactttgaagaagagttc
catgaggttgaagaagtcctcaaagtagaagagtatagagctgaagaagtacacgaagtt
gaagaagtccatagggtaatagaagtcttagaggctgaagaagtggaagtatatgaaaaa
cccaaagctccacctaaagggcctgagatatccgagaaaatcatccctccaaaaaaacca
cctactaaagttgttcttcgaaaagagccaccagctaaagtacctgaagtacccaagaaa
attgtggtagaagaaaaagtacatgtttctgaagagcccaaagttccaccagctaaagtg
cccgaggctcccaaggaagttgtccctgaaaagaaggtgcctgtgatgcctcctaaaaag
ccagaagtcccacctgctgaagtgcctgaggctcccaaggaagttgtccctgaaaagaag
gtgcctgtgatgcctcctaaaaagccagaagtcccacctgttacagtgcccgaggctccc
aaggaagttgtccctgaaaagaaggtgcctgtgatggctcctaaaaagccagaagtccca
ccagccaaagtaccggaggtgccaaaggcagctgtcccagaaaagaaggtgcctgaagct
attcctcccaaaccggaaagtcctcccccagcagtgcctgaggtgccaccaaaggaagcc
atccctgagaagaaagtgcctgtggctcctcctaaaaagccagaagctctacctgctaaa
gttcctgaagttcctaaagaagttgtacctgaaaagaaagtggctgtacccaaaaaacca
gaagtcccacctgctaaagctactcaagaagttgtcccagaaaagaaagttcccaaggca
ccacccaaaaaactggaagccccacctgtcacagtgcctaaagttcctcaagaagtggtc
ccagaaaagaaagttcctaaggcaccacccaaaaaaccggaagccccacctgtcacagtg
cctgaagttcctcaggaagttgtcccagaaaagaaagttcccaaggcaccacccaaaaaa
ccagaagtcccaccagtttcagtgcctgaagttcctcaagaaattgtccctgaaaagaaa
gcaccagtggcacctcctaaacagctggaagccccacctattacagtacctgaggctcca
aaagaagttgtccctgaaaagaaagtacctgtgatgcctcctaaaaagccaaaagtccca
cctgttacagtgcccgaggctcccaaggaagttgtccctgaaaaggtgcctgtgatgcct
cctaaaaagccagaagtcctacctgttacagtgcctgaggctcccaaggtaattgtccct
gagaagaaagtacctgtgatggctcctaaaaagccagaagtcccacctgttacagtgccc
gaggctcccaaggaagttgtccctgaaaagaaggtgcctgtgatgcctcctaaaaagcca
gaagtcccacctgctgaagtgcctgaggctcccaaggaagttgtccctgaaaagaaggtg
cctgtgatgcctcctaaaaagccagaagtcccacctgctgaagtgcctgaggctcccaag
gaagttgtccctgaaaagaaggtgtctgtgatgccccctaaaaagccagaagtcccacct
gttacagtgcctgaggctcccaaggaagttgtccctgagaagaaattacatgtgatgcct
cctaaaaagccagaagtcccaccagccaaagtaccggaggtgccaaaggcagctgtccca
gaaaagaaggtgcctgaagctattcctcccaaaccggaaagtactcccccagcagtgcat
gaggagcctgaggaaactgccccagaagagcctccagctgaagtcgtggaagagccagag
cctgctcctcctccaaaagtgaccgtgccacctaagaaacctgtcccagaaaagaaacca
cctgccgtcattgccaagaaacctgaaccaccaccagtgaaagtgcccgaggtgcccaag
gaagttgttcctgaaaagaaagtgcctccagtggttcccaaaaaaccagaagtcccacct
gctaaagtgcctgaagttccaaaagaagtccttccagaaaagaaagtagctgttcccaaa
aagcccgaagtcccaccagctaaagtgccagaggtaccaaagaaacctgtcttagaagag
aaaccagtcgtccctgttccggagaaagtagagtcccctcctccagaagtatatgaagaa
cctgtagaaattgctcctgaagaggaagagccagttcctgttgcagaagagaaggaacca
gaagccccacctccggcagtgcctgaagagcccaagaagattgttccagagaagaaagtt
cctgtcatcaaaaaagcagaacctccaccacctaaagaacctgaacctgaaaagaaggtt
attgagaaaccaaaacccaaaccaaagcccccagctcctcctccagctccacctaaggaa
gacctgaaggagaaaatgttccagcttaaagctatttcaaagaagaaagttcctgaaaaa
cctgaggctctggaagcagtggagcttacacctctgaaagtgcttggaggtgaaaagaaa
gttcgcaaattacttcctgaacctaaacctcaaccaaaggaagaagctgttctcaaaagc
gttctaagaaagagacctgaagaagaacctaaagaagaacctaaagaagtagaaaaaatt
aaaaaacctgcagtgccagaaccacctccaaaagctgttgaagaggttgaagcacctcca
gctactgttaccaaaagggaaaggaaagttcctgaaccagcaaaagtgcctgaaattaag
ccagcaatacctctcactgcacctgaaccaaaaccaaagcctgaaccagaagtgaaaata
atcaaaccacctcctttggagcccacaccagcccctatcgctgccccagtgacggtgcca
gtcgctggagagaaagcagaagccaaagcaccgaaagaggaggctgccaagccaaaagtt
cccatcacaggtgtagccaaaaagactccttcaccaatagaagctgaaaggaaaaagtta
agaccaggaagtggtggagagaaaccgcctgccgaagctccgttcacctaccagctgaag
gctgtgccactgaagtttgtgaaagaaatcaaagacattgttttgactgaagcagagtca
gttggctcttctgcaatctttgagtgtttagtctccccctccactgcagttacaagctgg
atgaaagatggtagcaatatccgtgagagcccaaagcacagattcatcgctgatgggaaa
gacagaaagctgcatatcattgatgttcagctttctgatgctggcgaatacacctgtgtt
ttacgtctgggaaataaggaaaagacctccactgcgaaactgattgtcgaagaacttcct
gtgcgttttgtaaaaacgcttgaagaggaagtcacagtggtcaaaggacagccattgtac
ttgagctgcgacttaaataaagaacgtgatgtggtctggaggaaggatggcaagattgtg
gtggagaaacccggcaaaattgtgcccagcatcattggcttgatgcgggccctgaccatc
aatgatgcagatgactccgatgcagggacgtacacagtgactgtggaaaacgccaacaac
ctggagtgctcatcctgtgtgaaagtagtagaagtcattagagactggctggtgaaaccc
atccgagatcagcatgtgaaacccaaggggacagctgttttcacctgtgtcatagcaaag
gatactccaaacattaagtggttcaaaggatatgatgaaatccccttggaaccaactgat
aagactgagatagtaagagatggaaatcatatacacctcaaaattaagaatgctgtgcca
gaagatattgatgaatattcagtggaaattgaagggaaaagatactctgcaaagctgaca
cttggagatcgtgaagttgaattgcttaaaccaatagaggatgttaccatttatgagaaa
gaaagtgcaagctttgatgcagaaatctcagaggcagacattcccggagagtggaaactg
aagggagaacttctaagaccctcacctacgtgtgaaatcaaggcagatggtggcaaacgc
ttcctgactctgctcaaagtcaaactggaccaggccggtgaagttctttaccaggcactt
aatgcagtcacgactgccattctgacagtaaaagaaatcgaacttgactttgccgtgccc
ctgaaggatgtcacggtcccagaaaagcgacaggctcgatttgaatgtgtcctcactcga
gaggcaaatgttatatggtctaaaggacctgatataatcaagtcatctgacaagtttgat
atcattgctgatggaaagaaacacattcttgtcatcaataattctcagtttgatgatgaa
ggggtctatactgctgaagtggagggcaagaagacctcagcaagattatttgttacaggt
ataagattgaaattcatatcacctcttgaagatcaaacagtgaaagaaggtgaaacagca
acttttgtctgtgaactttctcatgaaaaaatgcacgtagtctggttcaaaaatgatgtc
aaactccacacaagcaggactgtactcatctcatcggagggcaagcttcacaagctggaa
atgagagaagtgacaccggatgatatatcccagatcaaagctcaggttaaggacctgagc
tccacagcaaatctgaaggtcttagaggccgatccctacttcactgtgaaattacatgat
aagactggagtcgagaaggatgagattattctgaagtgtgaagtgagcaaagatgtgcca
gtgaaatggtttaaagacggggaagagattgtaccttcacccaaatactctatcaaggca
gatggcctgcgccgcatcttaaaaatcaaacaggcaaaactgaaagacaaaggcgaatac
acgtgtgactgtggcacagacaagacaaaagcaaatgtcactgttgaggcccaactaata
aaagtggaaaaacctctgtatggagtagaagtgtttgtgggtgaaacagctcgctttgaa
atcgaactttctgaaccagatgtccatggccagtggaaattaaaaggagagcctttaact
gcttcccctgactgtgaaatcattgaagacgggaagaagcatattctggtcctttataac
tgccagctggatatgacaggcgaggtctccttccaagccgccaacgctaaatctgcagcc
aatctgaaagtgaaagaattgccacttatcttcatcacgcctctcagtgatgttaaagtc
tttgagaaagatgaggctaagtttgagtgtgaagtatccagggagcccaaaacatatcgt
tggctgaaaggaacccaggaaatcacaggtgatgacaaaactgagcttattaaggatggc
actaggcattcgctggtgatcaaatctgctgcttttgaagatgaagcaaaatacatattt
gaagctgaagataagcacacaagtggcaaactgatcattgaaggaatccgactcaaattc
ctcaccccactcaaggatgtaacagccaaagagagggaaagtgctgtgtttactgtggag
ctgtcccatgataacattcgtgttcgctggttcaagaacgaccagcgcctgcataccagc
aagttggtctcaatgcatgatgaagggaaaacccattccatcacattcaaagacctctct
attgatgacacctctcaaattaaagtagaagctatgggtttaagttcagaagccaaactc
actgtgctagagggagatccatactttacaggaaagcttcaagattacactggcacagag
aaaagtgaagtgattctacagtgtgaaattagcaaagcagatgcaccggtgaaatggttt
aaagatggacaggagataaagccatctaaaaatgctgttattaaggcagatggcaagaag
cgcatgctaatcctaaagaaggccttgaaatcagatattggacagtacacctgtgactgt
gggacagataagacctcaggaaagcttgagattgaggatcgggaaattaaactggtgcga
cccctgtacagtgtggaggtgatggagactgagacggcccgctttgaaaccgaaatctcg
gaagatgatatccacgccaactggaaactcaagggagaggcactactccaaacacctgag
tgtgagatcaaggaagaaggcaaaatgcacttccttattttgcacaactgccgactggac
cagaccggtggggtagatttccaagctgccaatgttaaatctagtgcccacctccgagta
aaaccacgagtcattggtcttctgaggcctctaaaggatgtcacagtgactgcaggagaa
acagccaccttccactgcgagctgtcttatgaggatatcccagtggaatggtacctcaga
gggaagaaactagagcccagcgataaggtggtcacacgttcagaaggaagagttcataca
cttactctgcgggatgtaaagttagaagatgctggagaagtccaactagtagcaaaagat
ttcaaaacgcaagccaacctcttcgtgaaagaacccccagttgaattcactaaacctctt
gaggaccagacggtcgaagaggaagccactgcggtattggagtgtgaagtatcccgagaa
aatgctaaggtgaaatggttcaaaaatgggacagaaattctcaaaagcaagaagtatgaa
attgttgctgatggcagggtcaggaaacttattatacacggctgcaccccagaggatatt
aaaacatacacttgtgatgctaaggattttaagacttcctgtaacctgaacgtcgtgcct
cctcatgtggacttcttaagaccactcaccgatcttcaagttaaagaaaaagaaatggct
cggtttgagtgtgaaatttcccgagaaaatgccaaggttcagtggtttaaagatggtgct
gaaattaaaaagggcaaaaaatatgacatcatatctaagggagcagtccgcattcttgtc
atcaacaaatgtctagtggctgatgaagcagaatattcctgtgaagtaaggacagcgcga
acttccggcatgctgacagtcctggaagaagaagctgtctttacaaaaaatcttaccaac
attgaagttagtgaaacagacactgtaaaactggtttgtgaggtctccaagcccggagca
gaagtaatttggtacaaaggggatgaagagatcattgaaacaggaagatatgaaacactt
actgttggacgaaagagaatcctgatcattcagaatgctcacctggaagacactggcaac
tacaactgccgactcccaagttctcgaaccgatggcaaagtcaaagttcatgaacttgct
gctgaatttatctcaaagcctcaaaacgttgaaatacttgaaggagaaaaggctgaattt
gtctgctctctatcaaaggaaagctttgcagtccagtggaagagagatgataagacactt
gaatctggagataaatatgacataattgctgatggcaaaaagaggatcctagttgtgaaa
gatgccacattacaagatatgggcacttatgtagtcatggctggggccgccagagcagcg
gctcacttgacagtaattgaaaaactcaggatcatagttcctctgaagaacacccgtgtg
aaggaacaacaagaagctgtctttaactgtgaggtcaataccgaaggtgccaaagccaaa
tggttcagaaatgaagaagccatatttgatagttcaaaatacattattctccaaaaagac
ctggtctacaccctcagaattagaggtgcacaattagatgatcaagccaactataatgtg
tctctgaccaatcacagaggtgaaaatgttaagagtgcagccaatctaattgtagaagag
gaagaccttaggatcactgagcctcttaaagatattgaaacaatggagaagaaatctgtc
acattctggtgcaaggtgaaccgtctcaatgtaagactgaactggaccaaaaacggagaa
gaggtgacttttgacaaccgtgttttatacagaattgataaatataagcactctctaatc
attaaagactgtggcttcccagatgaaggtgaatacattgtcactgctggacaagataaa
tctgttgctgaacttctcatcatagaagcccctacagaatttgtggaacacttggaagac
cagacagtcactgagtttgacgatgctgtcttctcctgccagctctccagagagaaagca
aatgtaaaatggtacagaaacgggagagaaatcaaagaaggcaaaaaatacaaatttgaa
aaagatggcagaatacatagactcattataaaagactgcaggctggatgatgaatgtgaa
tatgcttgtggagtagaagacaggaggtctcgagctagactctttgtggaagaaatccct
gttgagatcatcaggcctccccaagacatccttgaagcccctggtactgatgttgtcttt
ttagctgagctcaacaaagataaggtggaagtccagtggctaaaaaacaacatgattatt
gtccagggtgacaaacaccagatgatgagtgaaggaaagatacacaggctacaggtctgt
gacattaagccccgtgaccagggtgaatacagatttattgccaaagacaaagaagccaga
gctaagcttgaactggcagccgcacctaaaatcaagacagctgaccaagacctggtggtt
gatgttggccagcctctgaccatggtggtgccctatgatgcctaccccaaggcagaagct
gagtggtttaaggaaaatgaacctctatcttcaaaaactgttgatactacagctgaacag
acttctttcagaatttcagaagccaagaaaggagacaaaggaaggtataaaattgtgctt
cagaacaaacatggaaaagcagaagcattcatcaatttacaagttatagatgttcctggg
ccagtacgtaacttagaagtgacagaaacatttgatggtgaagtgagcctcgcttgggaa
gaaccattaactgatggtggaagccaaatcataggttatgttgttgaaagacgtgacatc
aagagaaagacctgggttctggccactgaccgtgcagacagttgtgagtttactgtcact
agactacaaaaaggaggagctgagtacctattccgtgtgagcgcaagaaacagagtcggc
actggtgaaccagtagaaactgacagtcctgtagaagcgaggagtaaatatgatgttcca
ggccctcctttgaatgtaacgatcactgatgtgaacagatttggtgtctcattgacatgg
gaaccaccagagtacgatggaggtgccgagatcacaaactacgtcattgaattaagggac
aagacttctgtcagatgggaaactgccatgacagtaagagctgaagacctgtctgcaact
gtcactgatgtggtggaaggacaggagtacagtttccgggttagggcccaaaaccgaatt
ggagttggaaaaccaagtgcagccacacccttcatcaaagttgctgatccgattgagaga
ccaagtcctcctgtgaacctaaactcctcagatcagactcagtcatcagttcagctcaca
tgggaacctcctctgaaagatggaggaggcccaatattgggctatataatagaacgatgt
gaagaaggaaaagataattggattcgttgcaataagaaacttgtcccagaactgacttac
aaggttactggattacaaaaaggaaataaatatttatatcgagtatctgcagaaaatgaa
gttggtgtttcagatccatctgaaattcttggtcctctaactgctgatgatgcatttgtt
gaaccaacaatggatttaagtgcatttaaagatggcctggaagttattgtgccaaatcct
atcaagatcctggttccaagtacaggctatccaaggccaactgctacctggtcttttgga
gataaagtactagaagcaggagaccgtgtgaaaatgaaaaccctatctgcctatgctgag
cttatcatttctccaagtgaacgtccagacaagggcatttacacgctgaagttagaaaat
cgtgtgaaagcaatttctggggagattgatgtcaatgtaattgctcgcccaagtgcaccc
aaagaactgaaattcggtgagataacccaggactcagtacatttgacttgggaaccacca
gatgatgatggaggaagtccattaaccggatatgttgttgaaaagcgagaagtcagccgg
aaaacatggactaaagttatagactctgtgagcaacctagaattcacagttgctgatctt
gttcaaggaaaagaatatttatttaaagtctgtgctcgtaacaagtgtggccctggagaa
cccgcatatgttgatgaacctgtaaatatgtcagctcctgcaacggtacctgacccacca
gagaatattaagtggagagatcgaacagccaagagcatcttcctaacatgggatccacct
aaacatgatggtggttcacgcatcaaaggatatatagttgaaaaatgtccacgtggttct
gatcgatgggtcgcttgtggagacccagttgcagaaacaaaaatggaagtaacaggtctt
gaagaaggccagtggtatgcctatcgcgtgaaggccttgaacaggctaggagctagcaag
ccaagcaaacccacagaagaaatccaggctgtggacacacaggaggctccagaaattttc
ctcgacgtgaagctccttgcgggtctcactgtaaaagcgggaactaagattgaacttcct
gccactgtaactggcaaacctgaacctaaagtaacctggacaaaggctgatatgcttctg
aagcaggacaaaagaatcaccattgaaaacgttcctaaaaaatccacagtgacgatcgtg
gatagtaagagaagtgacagtggcacatacattatcgaggccatgaacgtctgtggtcgg
gccactgctgtggtagaagtgaacgtcttagataaacctggacccccagctgctttagat
atcatggaagtgaccaacgagtcatgtcttctcacatggaacccaccacgcgatgatggc
ggatctaaaatcacaaactatgtcgtggagagaagagcgaccgacagtgatatgtggcac
aagctctcgtcaactgtcaaggatacaaagttcaaggcaaccaaattaacacccaataaa
gaatacatcttcagagttgctgcagaaaacatgtacggtgttggtgagccagttcaggcc
actccaataacagccaaatatcagtttgatccacctggacctccaactcgcctagaacct
tctgatatcactaaggatgcagtgaccctcacatggtgtgagccagatgatgacggtggc
agccccatcacgggttactgggttgaaagattagatcctgatactgataaatgggttaga
tgcaataagatgccaataaaggatacaacatacagagtgaaaggtcttaccaataagaaa
aaatacagattccgtgtgttggctgaaaatcttgctggacctggaaaagcaagcagatca
actgagccaatcttaataaaggatcccatagatcctccatggccccctggaaaaccaacc
gtgaaagatgtaggcagaacatcattaatgctgaattggacaaagccagaacacgatgga
ggggcaaagatcgattcttacgtcattgaaatgctaaagactggaacagaggactgggtc
cgagtggccgaaggggttcccaccaccgagcatttgttcccagggctcatggaagggcaa
gaatactcattccgagttagagctgtgaacaaggcgggcgaaagtgaacccagcgaaccc
agtgactctgtgctttgccgggagaaactttatcccccatcaccacctcgttggcttgaa
gttatcaatattacaaaaaatacagcagacctaaagtggacggttcctgagaaagatgga
gggtcgcccatcaccaactacattgtggaaaagagagacgtgaggcggaaaggctggcaa
acagtggacacaactgtcaaggacaccaagtgcacagtgaccccactgaccgagggttct
ttatacgtgttccgagttgctgcagaaaatgccataggacagagtgactattgtgaagtc
gaggactctgtcctggccaaagacacctttaccacccctggaccaccctacgctctgaca
gtggttgatgtgacgaaaggacatgttgacctgaagtgggaaccacctaaaaatgatggt
ggaagaccaatacagagatatgtcattgagaagaaagaaaagttaggtacccgttgggtg
aaagctgcaaagacctcaggacctgactgtaactttaaagtaactgatgtcattgaagga
acagaggtccagtttcaggttcgggcagagaatgaagctggagttggacacccaagcgaa
cccacagaaatcctgaaaattgaagatccaacaagtcctccttcacctccccttgacctg
catgtgactgatgctgggagaaagcacattgccattgcttggaagcctccagagaaaaat
ggtggaagtcctattataggataccatgttgaaatgtgtccagtaggcactgagaaatgg
atgcgggttaattctcgcccaataaaagacttgaaattcaaggttgaagaaggtgttgtg
cccgacaaggagtatgtcctgagagtgagagccgtcaatgctgttggtgtcagtgagcca
tctgaaatctccgaaaacgtggttgccaaagacccagactgcaagccaacaattgatctg
gagactcatgacattgtcgtcattgaaggtgaaaaattaagcattcctgttcccttcaga
gctgtcccagttccaaccgttagctggcataaagatggcaaagaagttaaagcaagtgat
agattaacaatgaagaacgatcacatctctgcacaccttgaagttcccaagagtgtccat
gcagatgctggagtttacaccattaccgtggagaataagctcggctcagcaactgcctca
atcaatgtcaaagtcataggactacctggaccatgcaaagatcttaaagcaagtgatgtg
accaagagttcttgtaaattaacctgggaacctccagaatatgatggtggaagcccaatt
cttcattacgtcctagaacgcagagaagctgggaggaggacgtatataccagtcatgtct
ggtgagaacaaactgtcttggactgtcaaagatctcataccaaatggtgaatacttcttc
cgtgttaaagctgtcaacaagattggtggaggcgaatatattgaactgaaaaatccagta
attgctcaagatccgaagcagccccctgatccacctgtagacgttgaggtacataatcct
acagccgaggcagtgactattacatggaagccacctttgtacgatggagggagcaagata
atgggttacatcatagagaagattgctaagggtgaagagagatggaagagatgcaacgaa
cacctggtaccagtcctgacctatacagcaaaaggccttgaagagggaaaggaataccaa
ttccgtgtgcgagcagaaaatgctgctggcattggcgaaccttctcgggccactcctcca
accaaagcggtagatcctattgatgccccaaaagtcattatgagaacaagcctagaagtg
agacgaggtgatgaaatagcactcgatgcaattatttctgggtcaccttacccaactatt
acgtggctaaaggatgaaaatgttatcacaccagaggaaattaggaagcgggtagcaccc
ctggttaggaggaagaagggtgaagttcaagaagaagaagaaccatttgtcctgcctctg
acacagcgtttgagtattgacagtagtaaaaaaggagaatctcagctacgtgtccgagac
tctctccgacctgatcatggcctgtttatgatcaaagctgaaaatgaccatggtattgca
aaagctccttgtaccgtcagtgtgctagatataccaggaccaccaatcaactttgtattt
gaagatattagaaagacctcagtcatctgtaaatgggaaccaccccttgatgatggtggc
agtgaaattttaaactacactttggaaaagaaagacaagacaaaacctgactcagaatgg
attgtcgtcacttcaacacttagacattgcaaatattcagtgacaaagttgattgaagga
aaagagtacctcttccgcgtcagagctgaaaataggtttgggcctggaccaccatgtgtt
tcaaagccacttacagctaaagatccatttgaaccacctgatgcacccgataagcccact
gtggaagatgtcaccagtaacagtatgctagtgaaatggaatgaaccaaaagataatgga
agccccatcttgggttactggcttgaaagacgtgaggtgaatagcacacactggtctcgt
gtcaaccgaaaccttctgaattctttgaagaccaatgtagaaggcctattagagggactc
acctatgtcttcagagtatgtgccgaaaacgcagctggacctggaaagttcagtcccccc
tcggatcccaaaacagcacgtgatccaatctctccacctgggccacctgtcccaagagtc
aatgacacaagttccacaactattgaactagcatgggaacccccagctttcaatggtggt
ggggaaattgttggctactttgttgataagcagctggttggcacaaatgaatggtcccgc
tgcacagagaagatgatcaaggcccgtgagtacactgtcaaagaaatccgagagggtgcc
gattacaaacttcgagtgagcgctgtcaacgccgcaggtgaaggaccgcctggagaaaca
gaacccgttactgtggctgaaccacaagagcctccaaatgtggaactagatgtttctgtc
aaggctggaatacagatcgtggctgggaagactctcagaattccagctgtggtaactggt
cgtccagtgccaacgaaagtgtggaccaaagaagaaggagagctggataaagaccgtgtt
gaaatagagaacgttggaaccaaatctgaactaattatcaagaatgcattaagaaaagat
catggcagatatgtgattacagctaccaatagctgtggttctaaatttgcagcagcccgg
gtagaagtttttgatgtccctggtccagttcttgatttgaaacccgttgtaacaaacaga
aaaatgtgtctgcttaactggtctgatccagcagatgatggaggaagtgatatcacgggc
tttattattgaaagaaaggatgctaagatgcacacttggagacaaccaatagagactgag
agatctaaatgtgacatcacaggtctccttgagggacaagaatatatgtaccgtgtgatt
gccaagaacaagtttggctgtggccctcctgttgaaataggaccaattcttgcagttgac
ccactaggtcctccaacgtctcccgagaggcttacatatacggaaaggaccaagtccact
atcaaccttgactggaaagagccccgcagtaatggtggctgccccatccaaggctatatc
attgaaaaacggcgtcatgacaaacctgactttgaaagagttaacaagcgactctgccca
accacatctcttctggttgaagatcttgatgaacaccaaatgtatgagttccgtgtcaag
gccgtcaacgaaattggtgaaagcgaaccatccctgcctcttaatgtggtcatacaagat
gatgaagtgcctccaactattaagttgcgcctgtctgttcgaggagacaccatcaaagtt
aaggcgggagagcctgttaacatccctgcagatgtgacaggccttccaatgcctaaaatt
gagtggtccaagaatgaaactgtgattgaaaaacccaccgatgcacttaagataaccaag
gaagaagtatcccgaagtgaggcaaagactgagcttagcattcccagagcaacccgggag
gacaaaggcacttacacggtgactgcttctaatcgccttggctcagtgttccgaaatgtc
catgttgaagtatacgatcgtccatccccaccaagaaatcttgctgttgttgacattaaa
gctgaatcttgccacttaacgtgggatgcccctctagacaatggtgggggtgaaatcacc
cattatgtcattgacaaacgcgatgcaagcaggaagaaagctgaatgggaagaagtcacc
aacactgctgtagagaggagatatgggatctggaaacttatccccaatggtcagtatgag
ttccgagttagggcagtgaataaatatggaaccagcgatgaatgcaaatcagataaagtg
gtcattcaagatccttatcgcactcctggacctccgggaaagccaacagttttggagcgc
accaaagggtcgatgctagtgagctggactcctcctctggacaacggcggctctccaatt
actggctactggctggagaagagagaagagggaggtgcctactggtcacgtgttagccga
gcaccgataaccaaagtgggattgaaaggcgtggaatttaatgttccccgtttgattgaa
ggtgttaaataccagttcagagcgatggcaataaatgctgcaggagttggctctcccagt
gaaccatcagacctagctgttgcaggagatcccatatatccacctgggccaccttctcgc
ccagaggtcaaagataaaacaaagtcaagcatctcactagcatggaaacctccagccaaa
gatggtggcagtccgatcaaaggatacattgtagaaatgcaagaagaaggtactactgac
tggaaaagcgtaaacgaaccagacaaacttctaactacctgtgaatgtgtggtgccgaat
ttgaaagagctcaggaagtacagattccgagtgaaagctgtcaatgaagctggtgaatct
gaaccaagtgatacaactggagagatccctgccactgatattcaagaggtaccagaaatt
ttcattgacattggagcacaagactgtctggtatgtcaagctggcacacagattaggatt
cctgctgtcatcaagggacgcccaacaccaaaatcatcttgggaatttgatggaaaggca
aagaaggcaatgaaggatggggttcatgacatacctgaagatgcacagctggagactgct
gaaaactcatccgtaattattattccggaatgtaaacgatcccattcaggcaaatacagc
atcacagccaagaacaaagcaggacaaaagactgccaattgcagagttaaagtcatggat
gtaccagggccacccaaagatctgaaagtcagtgacatcacaaggggtagttgcaggctt
acatggaagatgccggatgacgatggaggagacaggatcaaaggctatgtgatcgagaag
aggactattgacggaaaagcttggactaaagtcaatccaaactgtggaagcacttcattt
gtagttcctgacctcatctctgaacagcaatacttcttccgcgtgcgggcacagaaccgt
tttggtattggtgctcccgtggaaaccattcagaggaccactgccagagatccaatatat
cctcctgatccccctattaaactcaagattggcctcataacaaagaacacagtacacctg
tcatggaaacccccaaagaatgatgggggctccccggtcacccactatattgttgagtgc
cttgcgtgggatcctactgggacaaagaaagaagcgtggaaacagtgcaataagcgtgat
gtggaagaactggagtttacggtggaagacctggtagagggtggggaatatgaattcaga
gtcaaagctgtcaatgccgcaggagtcagcaaaccttcagccactgttggccccgtgact
gtcaaagaccagacatgcccaccttcaattgagctaaaagaattcatggaggttgaagaa
ggaactgatgttagcatcgtggccaaaattaaaggtgtgccattcccgacactaatctgg
tttaaagctcctccaaggaagcctgataacaaagaacctgttgtctacgacacccatgtc
aacaaactggtggtggatgatacctgcactctagtgattccacagtctcgcaggagtgac
actggcttatacaccatcacagctgtgaataatctgggaacagcatcaaaggaaatgagg
ctgaatgtccttggtcgccctggccctccagtgggaccaataaagttcgaatctatttca
gcagatcaaatgacactatcttggcttccacctaaagatgatggtgggtctaagattaca
aactacgtaattgagaaaagagaagctaacaggaagacatgggtgcgtgtctccagcgaa
cctaaagagtgcacatacacaattccaaaattgctagaagaccatgaatatgtattccga
atcatggcccagaataaatatggcattggggaacctcttgacagtgaaccagaaacagca
agaaacctcttctctgtccctggagcaccagataaaccaacagttagcagtgtgactcga
aactacatgactgtcaactgggaagagccagaatacgatggaggctctcctgttacagga
tactggctagaaatgaaagacaccacttcaaagagatggaagagagttaaccgagatcct
atcaaagccatgactttgggtgtttcttataaggtgactggtcttattgaaggttctgat
tatcaattccgggtatacgcaatcaatgctgctggtgtgggtccagcaagtctgccatca
gacccagtgactgctagagatcccactgcccctcctggacctccatttcccaaagtcaca
gactggactaaatcatctgtggatttggagtggtctcccccactaaaagatggtggatcc
aaaataacgggatacatcgttgaatataaagaagaaggaaaagaagaatgggaaaaggct
aaagaaaaagaagtgagaggaacaaaacttgttgtgacaggattaaaagaaggagcattc
tacaaatttagagttagagcagtcaacattgccggcatcggagaacctggagaagtcaca
gatgccattgaaatgaaggacaggattgtattacctgaccttcagttagatgccagcgtc
agagacagaattgtggtccatgctggaggggtgattcggatcatcgcctatgtatctggc
aagcctcctccaaccgttacctggagtatgaatgaaaaagctttacctcaagaggccacc
attgagaccacagccattagctcatccatggtcatcaagaattgccagaggagccaccaa
ggcatctacgctctccttgccaaaaatgcagggggcgaaagaaagaagacaattatcgtt
gatgtattagatgtgccaggtcctgttggaataccattcctgtctcacaacctaaccagc
gactcctgcaaactgacatggttttctccagaagatgatggaggctctccagtcaccaat
tatgtcattgaaaagcgggaagatgaccgcagagcatggaccccagtgacatacacagct
acccgacaaaatgccaccgtccagggtctcattcaaggaaaagcctactttttccgaatt
gcagctgaaaatagtattggcatgggcccgtttgttgagacaacagatgcgcttgtcata
agagatccaataactgtaccagagcgtcctgaagacctagaagtcaaagaagttactaaa
gattctgttactctgacttggaatccccctaagtatgatggcggatccgaaattatcaac
tatgtcctagaaagccgtctcattggaactgagaagttccacaaagttacaaatgacaac
ttgcttagcaggaagtacagtgtgaaaggcttaaaagaaggcgatacctatgagtaccgt
gtcagtgccgtcaatattgttggacaaggcaaaccatcattttgcaccaagccaatcact
tgcaaggatgagctagctcctccaacgcttgagctcgacttcagagataaactcacgatt
cgagttggtgaagcttttgccctcactggccgttactcaggcaaaccaaagcctaaggtt
acttggttcaaagatgaagttgatgtgctagaagatgattgcactcatataaagacctcg
ccaacaacacttgctctagagaagctcaaggccaagcgttcagattctggcaaatactgt
gtggttgtggagaacagtacaggctccaggaaaggtttctgtcaagttaatgtcgttgac
cgtcctggaccaccggtaggaccagttgtttttgatgaggtgaccaaagattacatggtt
atctcttggaagccacctttagatgacggaggcagtgaaattactaattacattattgag
aagaaggaagtgggcaaagacgtttggatgcctgtgacatctgcaagtgctaaaacaaca
tgcaaagtttctaaactgcttgaaggaaaagattatattttccagatacatgctgaaaat
ctgtatggaataagtgatcctctggtgtctgattcaatgaaagccaaagatcgtttcagg
gttcctgatgcacctgaccagccaattgttacagaagttaccaaagactctgcattagtc
acctggaacaaaccaaatgatggaggaaagcccatcacaaactacatcctggaaaagagg
gaaactatgtctaaacgatgggctagagttaccaaagagcctatccatccatacactaag
tttacggttcctgatcttctagaagggtgtcagtatgaattccgggtttctgcagaaaac
caaattggtattggagacccaagcccaccatccaaaccagtctttgctaaagatccaatt
gtgaaaccaagtccacctattaatcctgaagcaataggtacaacacataattcagttgat
ctaacctggcagccaccacgtcatgatggtgggagcaagattctgggttatattgttgaa
taccagaaagttggagatgaagaatggaaaagagccaatcacactcctgagtcatgtcct
gaaactaactataaagtcactggccttcaggatggtcaatcctataagttcagagtaata
gcagtcaacgtagcccgtgaatcagatccagctcatgttcccgagccagtgctagtaaaa
gacagatttgaaccccctgagttgattcttgatgccaacatggcaagagaacaacacata
agggttggtgatactctaagacttagtgccgtcatcaaaggagtgccgttcccaaaagta
acttggaaaaaagaagacagagaggctccaactaaagcaagaattgatgttactccagtt
ggtagcaagcttgaaatctgtaatgctgcccacgaagatggtggaatgtattccttaaca
gtggagaatctagctggttcaaaaactgtctcagtaaaagtactcgtattagataagcct
gggccacctagagatctggaagtcagtgaagttaggaaagattcttgttaccttacttgg
aaggaaccactggatgatggtggttctgttattacgaattatgtggttgagaggagagat
gttgccagtgtccagtggtcacctctttcaactacatcaaagaaaaagagccactttgct
aaacatcttactgaaggcaatcagtatgtcttccgagtagctgctgagaaccagtatgga
cgtggtccttttgtagaaacacctaaacccatcaaggctctggatcccctacatcctcca
gggccacccaagaacctacaccatgtagatgttgacaagactgaagtctcccttgtttgg
aataagccagatcgtgatggtggctctccaatcactggatatttggtggaatatcaagaa
gagggcacccaagactggattaagttcaagactgtgacaaacttagagtgtgttgttacc
ggactacagcaaggaaagacctatagattccgtgtaaaagctgaaaacattgtgggtctt
ggtcttcctgacacaactatcccaatagaatgtcaagaaaaactagtgcctccatctgtg
gagctggatgtgaaattaattgaaggccttgtggtaaaagctggaactacagtcagattc
cctgccattataagaggtgtacctgttcctactgcaaagtggacaaccgatgggaatgag
attaaaacagatgaacactatacagttgaaactgacaacttctcatcagtactcaccatt
aagaactgcttaaggagagacactggggaacatcagatcacagtttccaatgcagctggc
accaaaacagtggctgtacatcttactgttcttgatgttcctggtccaccaacaggccct
attaatattctggaagttacccctgaacatatgactatctcatggcagccacctaaggat
gatggaggaagccctgtgataaattatattgttgagaaaaaagacacaaagaaagacaca
tggggtgttgtctcttcaggaagcagtaagacaaagctgaaagtcccacatctgcagaag
ggctgtgaatatgtcttccgagtgaaagcagagaataagattggtgttggccctcccctt
gactccatacctactgttgctaaacataagtttagtcctccatctccccctggtaaacca
gtagtcactgacattactgaaaatgctgcaacagtgtcttggactctgccaaaatctgat
ggtggcagtccaataactggttactatgtggaacgtcgagaagtaacaggcaaatggatg
agggtcaacaaaacacctctagtggacatgaagcttagagtgactggactctatgaggga
aatacatatgagtttagagcttttgctgagaatcttgcaggactaagcaatccgtcccca
agttctgatccaataaaagcttgccggcccatcaaaccacctggaccacctattaatcct
aagctgaaagacaagaccagagaaacagctgacctggtgtggacaaagcctctcagtgat
ggtggcagccccattctgggctatgtagtggaatgtcagaaagctggagcaacacagtgg
agcaggattaataaagatgaactcattaggcaatgtgcctttagggtacctggactaatt
gaaggaaatgagtacagattccgtataaaggcagctaatattgtgggagagggagagcca
agagaactagcagaatctgtgattgcaaaggacatccttcatcctccagaagtagaactt
gatgttacctgtcgtgatgttattaccgttagagtgggtcaaactatccgcattcttgct
cgggtcaaaggcagacctcaaccagacataacttggtccaaggaaggcaaagcgttggcc
cgagaaaagcgggttgacctaattcacgatctacctcgtgctgagttgcaaattaaagaa
gccgttagagctgatcatggcaagtatatcatctcagctaagaacagcagtggacatgcc
caaggttctgctatcgttaatgtccttgacagacctggaccttgccagaatttaaagatc
agcaacgtaaccaaagagaactgtacaatttcttgggaaaaccctctagataacggtggc
tcagagataacaaacttcatagtggaatatcgcaaaccaaaccagaaaggctggtcaatt
gttgcttcagatgtcactaagcgattaatcaaggccaaccttttagccaaccatgaatac
tatttccgagtttgtgcagaaaataaagtaggtgttgggccaaccactgaaacaaaaact
ccaattctggctattaaccctattgatagaccaggtgagcctgaaaaccttcatattgca
gataaaggaaagacatttgtctacctaaaatggaggcggcctgattatgatggcggtagc
ccaaatctatcatatcatgttgaaaggaagctgaagggctctgatgactgggaaagagtg
cataaaggaagcattaaagaaacccactacatggttgacaaatgtgttgaaaaccagatt
tatgagttcagagtgcaaacgaagaatgaaggtggggaaagtgactgggtgaagacagag
gaagttgttgtaaaggaagacttgcagaaaccagtacttgatctgaaattaagtggtgtg
ctaactgtcaaagcaggggacaccattcgacttgaggcaggtgttagaggcaaaccattt
ccagaagtttcatggacgaaggacaaagatgcgacagacctaacaagatcaccaagggtc
aagattgctaccagtggtgattcatctaaattttctcttactaaagcaaagcgaagtgat
ggtggtaaatatgtaattacagcaactaatgtagctggcagttttgtggcctttgccact
gtcaatgttttagataagcctgggcctataagaaatctgaaaatttttgatgtgtgtagt
gataggtgttctcttcgctgggatccaccagaggatgatggtggctgtgaaatccaaaat
tatattttagaaaaatgtgagagcaagagaatggtttggtctacgttttctgctgctatc
ttaacacctggtactacagtaacacgtctcatagaagggaatgaatatattttcagagtc
cgtgcagaaaataaaataggcacagggcctccaacagaaagtaaatcagtcattgcaaaa
accaaatatgatagacctggtcgccctgaccccccagaagtcactaaagtaagcaaagaa
gagatgactgtggtttggacgccacctgaatatgatggtggaaagtccatcacaggatac
tatttggagaaaaaggaaaagcattcaacacgatgggtccctgtcaacaagagtgcgaac
cctgagagacgtttgaaggtacagaatctcctcccaggacatgaatatcagttccgtgtc
aaggcagaaaatgaagttggaattggagaaccaagcttgccatcaaggccggtggtggca
aaagaccccatagaaccacctggtccaccaaccaatctcaaagtggttgatacaaccaaa
agttccataactcttgggtggggaaaaccggtgtatgatggtggcgcaccaatcattgga
tatgttgtggaaatgagaccaaagagaccagatacatcacctgatgaaggctggaaaagg
tgtagtgctgcagcgcaactcgttcgcatggaatttaccgtgaccagcttggatgaaaac
caggaatatgagttcagggtttgtgcccaaaaccaagttggcattgggcgccctgcagaa
ctaaaggacgctattaaacctaaagaaatcctagaacctccagagattgatttggacgcc
agcatgagaaaactggtcacagtgagagcaggatgccctattcgactatttgccatagtg
agagggcgaccagcccctaaggtcacttggcgaaaagtgggtattgataacgtggtccga
aagggacaagttgatctggttgatactatggccttccttgtcatccccaattctacccgt
gatgactcaggaaaatattccctgacgcttgtgaacctggctggagaaaaggccgtgttc
gtgaatgtcagagtattagatactcctggacctgtgtctgatttaaaagtttcggatgtc
actaaaacatcatgccacatttcctgggcccctcccgagaacgatggtgggagccaagtg
acacattacattgtgcagaaacgtgaggcagatagaaagacgtggtcgacagtcacccca
gaagtcaagaaaacgagcttccacgtcaccaatcttgtccctgggactgagtatttcttc
agagtaactgctgtcaatgagtatggccccggcgtcccaacagacatccccaaaccagtg
ctcgcaacagatcctctaagtgagccggatccccccaggaaactagaagttactgaaatg
acaaagaacagtgctgcgttagcctggttacctcccctgcgcgatggaggtgccaaggtc
gacggctacgtcgttagttacagagacgaagagctccctgcaggtcactggacagagtac
tcggtggtgaaagacctcagccttgtcgtcaccggcctcaaggaaggaaagaaatacaaa
tttagggtagcggctagaaatgccgttggagtcagtttgccaagagaagctgagggagtg
tatgaagccaaagcacagctgttgccacccaagatccttatgccagagcaaattattatc
aaagctgggaagaaactccgaattgaagcccatgtgtatggaaagcctcatccgatctgt
aaatggaaaaaaggagaagatgaagttgtcacatccagccacctggcagtacataaagca
gacaattcttcagttctgatcataaaagatgttactaggaaagacagcggttactatagc
ctcactgcagaaaacagttctgggacagacactcagaaaatcaaagttatcgtcatggac
gttcctggaccccctcagcctccgtttgacatttctgacatagatgccgatgcctgctcc
ctgtcatggcacatccccctggaggacggaggcagtaacatcaccaattacatagtggag
aagtgtgacgtgagcaggggtgactgggtgacagcgctagcttcagtgacaaaaacttcc
tgcagggttggaaaactgatcccaggccaagagtatatcttccgggtccgtgctgagaat
cgatttggcatttcagagcctctcacatctccaaagatgctggctaagttcccatttgat
gttcccagtgaacccaagaatgcacgagtcaccaaagtcaacaaagactgcatattcgtg
gcgtgggatagaccagacagcgatggagggagccccattaccggctacctgattgaacgc
aaagaaagaaacagtttgctctgggtgaaagctaacgattcccctgtccggtcaactgaa
tatccctgtgctggcctggtagaaggccttgagtattcattcagaatctatgccctaaat
aaagctggacccagcccacccagcaaaccaactgaatatgtaactgcgagaacgccagtt
gatcctcctggaaagcctgaagttactgatgtttccaagagtactgtgtccctcatctgg
gcccgtccaaagcatgatggaggcagcaaaattgctggctatttcgtagaagcttgcaaa
cttcctggtgataagtgggtacggtgtaatacttcacctcaccagattccccaggaagag
tacacagctactggcctagaagagaatgctcagtatcaatttagagcaattgccaagact
gcggtaaacattagccagccttctgaaccttctgatccagtgactatcatggcagaaaat
gttcctcccaggatagacctgagtgtggctatgaaatctttgctcactgtgaaagctgga
actaatgtttgcctggatgctactgtttttggtaaaccaatgcccacagtctcttggaag
aaggacgggacgccgctgaaagcatcagaaggcatcaagatggccatgcagcggaacctg
tgtaccctggagctgttcagcgtgagtcggaaagactcaggggactataccatcactgcc
aaaaacgcaagtggctccaaatcagccaccatcaagctcaaagtgttagataaaccaggt
cctccagcatctgttaaaatcaacaaaatgtattcagatcgtgcaatgctttcttgggaa
cctcctcttgaagatgggggctcagaaatcaccaactatgttgttgacaaacgtgaaacg
agcagacccaactgggcacaagtctctgccactgtgcccatcaccagctgcagcgtggag
aaactgatagaaggccatgagtatcagttccgaatttgtgctgaaaataaatacggagtg
ggcgacccgatcttaactgaaccagcaattgctaaaaacccatatgacccacccggacgc
tgtgatcctcctgttattagcaacatcaccaaagatcacatgacagtaagctggaaacca
ccagcagatgatggcggctcccccatcactggctatttgcttgaaaagcgggaaacccag
gcaattaactggactaaggtcaacagaaaacccgttatagaaagaacgataaaagcaaca
ggtctccaagaaggcacggaatatgagttccgagttacagctataaataaggctggacca
ggcaaacccagtgacgtatccaaagctgcttatgcccaagatcctctgtatcctcctggt
ccaccagcttttcccaaagtatatgatacaacccatagctctgtgagtctatcttggggc
aagccagcctatgacggtggtagccctatcattggttaccttgttgaagtaaaacgagct
gattctgataactgggtgaggtgcaatttaccacagaagctacagaaaacccgctttgag
gttaccggcctaatggaaaacacagaatatcagttccgcgtgtatgccgttaataagata
ggatatagtgaccccagcgatgtgccagataaacactgtcccaaggacattttaattcca
cctgagggagaacttgatgctgatttgaggaaaacactcatattacgtgctggagttaca
atgagactgtatgtaccagtaaaaggacgtccacctcccaagataacttggtctaaacca
aatgtcaatctaagagaaaggattggactggacataaagtcaactgactttgacactttc
ttgcgctgtgaaaatgtgaacaaatatgatgcaggaaaatatatcttgactctgaagaac
agctgtggtacaaaagaatataccattgtagtgaaagtgcttgatactcctgggccaccc
gtcaatgtgactgtcaaagaaatatccaaagattctgcttatgttacctgggatcctccc
attattgacggcggaagccccatcataaactatgtggtagaaaagcgtgacgcagagagg
aagtcctggtccaccgtgacaacggagtgctccaaaacaagcttcagagtttctaacttg
gaggaaggaaaatcctacttcttcagggtgtttgcggaaaacgagtacggcattggtgat
cccagtgaaacacgtgatgccgtgaaagcttccgaaacccctggaccagttgtggacctt
aaagtgacgtctgtgaccaagtcatcttgtagcataggctggaaaaagcctcgcagcgat
ggtgggagtcgaattatcggatatgtcgtcgatatcctgactgaagaaaataagtggcaa
cgagtaatgaaatcactaaacttacagtattccatgaaagatttgactgaaggggaggaa
tacaccttcagagtgagtgctgagaatgaaaacggagaagggaccccaagtgaaatcact
gttgtggcaaaggatgatgtcgtggctcctgaccttgacttaaaggaccttcctggtttg
tgctacttggctaaagaaaacagcaacttccgtcttaagatccccataaaaggcaagcca
gctccatctgtgtcctggaagaaaggagaggatcctctggcaacagacacaagggtcagt
atcgagtcatctgcagttaacacaactcttgtagtgaatgactgccaaaaatctgatgct
ggaaaatacacaatcacactgaagaatgttgccggcaccaaggaaggaaccctctccata
aaagttgtcggcaagcctggcatccccaccggaccgatcaaatttgacgaagtcacagca
gaagccatgaccttaaagtggggtcctccaaaggacgacggaggttctgagatcaccaac
tatatcctagagaagagagattcagtaaacaacaagtgggtgacatgtgcctcagctgtc
cagaaaaccacctttagagtcatgagacttcttgagggtatggaatacaccttcagggtc
agtgccgaaaataaatacggtgtaggagagggcttgaaatcggagccaattgttgctaga
catccatttgatgtgcccgatgctcccccacctcccagtattgtggatgtcagacatgat
tccgtatctctaacttggactgaccccaggagaactggaggctctccaatcacagggtat
catatcgagtccaaggaaagaaatagccttttgtggaagagggctaacaagactcctgtt
aggatgaaagacttcaaagtgacaggactaactgaaggtctggaatatgaattccgagtt
atggcaatcaatttagcaggagtaggcaagccaagcctgccatcagagccagttgtggca
cttgatccaattgatcctcctggcaaacctgaggttattaatgtaacaaggaattcagtg
actctcatttggactgaacccaaatatgatggtggtcataagttgactggatacatagtg
gagaagcgagatcttccctctaaatcttggatgaaagccaaccatgttaatgtcacagat
tgtgcctttactgttactgaccttgttgagggtggaaaatatgaattcagaattagagca
aagaatacagcaggtgctatcagtgctccatcagaaagtacaggaaccattatttgcaag
gatgaatatgaggcaccaaccattgtccttgatcccacaataaaggatgggctaacagtt
aaagcaggtgacaccattgttttgaatgccattagcattctcggcaagcctcttccaaag
tcaagctggtccagggcaggaaaagacatcagaccatcagacatcgttcagataacttca
accccaacatcttccatgcttgctatcaagtatgccactagaaaagatgctggtgaatac
accatcactgctaccaatgcttttggcacaaaggaggagcatgtgaaggtgacagtcctc
gatgtacctggtcccccaggtccgatcgaagtcagtaatgtttctgctgaaaaagcaacg
cttacatggacacctcccttagaagatggcggctcaccaattaagtcttatgttcttgaa
aagagagaaaccagccgacttttgtggacagtgtttgccgaagatattcagtcttgcagg
catgtggcaaccaaacttatccagggaaatgagtacctcttccgggtctcagctgtaaac
cagtatggcaaaggggagcccgtacagtccgaacctgtcaagatggtagacagatttggt
ccacctggcccccctggaaaaccagaggtgtccaatgtcactaaaaacactgccactgtc
agttggaaaagaccagttgatgatggtggcagtgagatcacagggtatcatgtagaaagg
agagagaagaaaggcttgcgatgggtgagagcaacaaagactccagtttccgatctcaga
ttcaaagtaacaggactgcaagaaggaaacacctacgaattccgtgtcagtgcagagaac
aaagcaggaattggtccacctagtgatacttcaaatcctgttctaatgaaagatgtagca
tatcccccaggaccaccctcaaatgcacgtgtcactgataccaccaagaaatctgcttct
ttggcatggggcaagcctcattatgacggtgggcttgaaatcactggctatgtcgtagag
catcaaaaagtaggagatgatgcctggataaaggatacgacaggaaccaccctcagaatc
accgagtttgtcgtccctgatcttcagactaaagaaaaatacaattttagaatcagtgcc
atcaacgatgcaggtgttggggagccagcagtgatttcaaatgttgaaattgtagaacgg
gagatggctcctgatttcgaactagatgctgagcttcgaagaacccttgttgtgagagca
ggactcagtattagaatatttgtgcccattaaaggtcgtcctgctcctgaagtgacatgg
accaaagatgatatcaaccttaaaaaccgagctaacattgaaagtacagagtcgttcacg
ctcctgatcatcccagaatgtaacagatatgacaccggtaaatttgtgatgaccattgaa
aaccccgctgggaagaaaagtggtttcgttaacgtcagagtcttggatacaccaggacct
gtccttaacctgaggcctactgacatcacaaaggagagtgtcaccctgcactgggacctc
ccactgatagatgggggctcacatataacaaactacattgtggagaaacgagaagcaaca
cggaaatcctactccacggtcaccactaagtgccataaatgcacatacaaagttactggc
ttgtctgaaggacatgaatacttcttcagagtgatggcagaaaatgagtatggaattggt
gagccgacagaaacaacagagcctgtaaaagcctccgaagtaccatcaccaccagacagt
cttaacattatggacataactaagagcacagtcagcctggcgtggcctaaacccaagcac
gatggtggcagtaagatcactggctatgtgattgaggcccaaagaaaaggctctgaccag
tggacccacatcacaaccgtgaaggggttagaatgtgttgtgaagaatctaactgaagga
gaagaatataccttccaagtgatggcagtgaacagtgcagggagaagtgcccctagagaa
agccgacccgtcgttgtcaaggagcagacaatgcttccagaattggatctccatggcatt
tatcaaaaattagtcattgctaaagctggtgacaacatcaaagttgaaattccagtgcta
ggtcgaccaaagcccacagttacatggaagaaaggagaccaggttcttaaacagacccag
agagttaattttgaaaacacagcaacttcaaccatcttaaatatcagtgagtgtgtaaga
agcgatagtgggccctacccattaacagcaaggaacattgtgggagaggttggtgatgtc
atcaccattcaagtccatgatatcccagggccacctactggaccaatcaaatttgatgaa
gtttcgtctgattttgtcaccttctcttgggacccacctgagaatgatggaggtgtaccc
ataagcaactatgtcgtagaaatgcgacagactgacagtaccacatgggttgagttagca
gccaccgttatacgcactacctacaaagccactcaccttactaccggagtggagtatcaa
ttccgggtaaaagctcaaaacagatacggagttggaccaggcatcacatcagcatctgta
gttgccaactatccatttaaggttcctgggcctcctggtacccctcaggtaactgcagtt
accaaggattcaataaccatcagctggcatgagcctctttctgatggtggaagccccatt
ttaggataccacattgaaagaaaagaacgaaatagtattctctggcagactgtgagcaaa
gcattagtaccaggcaacattttcaaatcaagtggtcttgcagatggtattgcttatgaa
ttccgagtgatcgcagaaaacatggctggcaaaagcaagccgagcaagccatctgaacct
atgtcagctttggatcccattgaccaacctgggaaaccggttcctctaaatattactaga
cacacagtgacccttaaatgggctaagcctgaatatactggaggctttaaaattaccagt
tatatagttgaaaagagagattttcctaatggacggtggctgaaagccaacttcagcaac
attttggagaatgaatttacagtcagcggactaacagaagatgccgcatacgaattccgc
gtgattgccaaaaacgctgctggtgctattagcccaccatctgagccatcagatgctatc
acatgcagggacgacattgaagcaccaaggataatggtggatatcatatttaaggacaca
attataataaaagcaggtgaagcattcaagctggaagctgatgtttcaggtcgcccacct
ccaacaatggaatggaccaaagatggaaaggagcttgaaaacacagcaaaattagaaatt
aaaatggcagatttctctactaatctggtaaacaaggattcactaagacgggatggcggt
gcctatacccttacagcaaccaatcccggtggttttgctaaacatattttcaatgtcaaa
gtccttgacagaccaggcccacctgaaggacctttagctatatctgaaatgacatcagaa
aaatgtgtattgtcatggttgcctccactggacgatggaggtgccaaaattgacaattat
gtagttcagaaacgtgaaaccagcagactggcatggacgaatgtagcttcagaagtccaa
gtaacaagactaaaggtcactaaacttttaaaaggcaatgaatacatattccgtgtgatg
gctgtaaataaatatggagttggagagccactggaatcagagcctgtgcttgcactagat
ccttatggaccacctgatccaccccaaaatcctgaagttacaactattactaaagattcc
atggttgtctgctggggacatcctgactctgatggcggcagcgaaatcatcaattatatt
gtggaacggcgtgataaagctggccaacgctgggtgaaatgcaacaaaaagactcttact
gatttaagatataaagtgtctggactgacagaaggacatgaatatgagttccggatcatg
gctgagaacgctgctggaatcagcgcaccgagtgctaccagtccattttataaagcctgt
gatgctgtgtttaaacctggcccgccaggtaacccgcgtgttctagatacaagcagatca
tccatttcaattgcttggaacaaacctatctatgatggtggttccgaaatcactgggtat
atggttgagatcgccctgccagaagaagatgaatggcatattgtcactccaccagccggg
ctcaaggcaacttcttacactatcaccaacctcacagagaaccaggaatataaaatccac
atctatgccatgaattctgaaggcattggggaacctgcacttgttcctggaactccaaag
gctgaagacaggatgctgcctccagagattgaactggacgctgaactgcgcaaagttgtt
accataagagcttgttgtaccctgagactttttgttccaatcaaaggaaggccagtacct
gaggtgaagtggactcgggaacacggagaatctttagataaagctagcattgagtccaca
agctcttataccctgcttaccgttggaaacgtaaacagattcgacagtggcaaatacata
ctaactatagaaaacagctcaggcagcaagtctgcatttgtcagtgtcagagtactggat
acaccaggccctccacaggatctgaaggtaaaggaggtcactaagacatctgtcacactg
acatgggagcctcctcttcttgacggaggttcaaaaataagtaactacattgttgaaaag
cgggaatcaacaaggaaagcatactcaactgttgcaacaaattgccacaagacttcctgg
aaggtagaccagcttcaagaaggctgtagttactacttcagggttctcgctgaaaatgaa
tatggcatcgggctgcctgctgaaaccgcggaatctgtgaaagcatcagaacgacctctt
cctccaggaaaaataactttggtggatgtcacaagaaatagcgtgtcactctcttgggag
aaacctgagcatgatggaggcagccgaattctaggctacattgtagagatgcagagcaaa
ggcagtgacaaatggaccacatgtgccacagtcaaagtcaccgaagccactattactgga
ttaattcagggtgaagaatactccttccgtgtttccgctcagaatgagaagggcatcagt
gatccgagacaactgagtgtgccagtagttgccaaggatcttgtcattccaccagccttc
aaactcctgttcaatactttcactgtactggcaggtgaagatctgaaagtcgatgttcca
ttcattggacgccctacgccaactgcaacctggcataaagatgatgtaccactgaagcag
acaaccagagtaaatgctgagagcacagaaaataactcactactgacgataaaggaagcc
tgccgagaagatgttggacattacgtagttaaactgactaactcagctggtgaagctact
gaaacccttaatgttattgttcttgacaaaccagggcctccaacgggaccagttaaaatg
gatgaagtgacagctgacagtatcactttctcctggggcccacctaagtatgatggtgga
agctctatcaataattacatcgtagaaaaacgggacacttccacaaccacatggcaaatt
ctgtcagctactgttgcaaggacaacaataaaagcttgcaggttaaagactggatgtgaa
tatcagtttaggattgcagctgaaaacagatatggaaagagtacctacctcaattcagag
cctactgtagcccagtatccattcaaagttcctggtcctcctggcacaccgttcgtaacg
ctctcctccaaggactgtatggaagtacaatggaacgagccagtcagtgatggaggtagc
aaagtcactggctatcatctagaacgcaaggagagaaatagcatcctctgggttaagttg
aataagacacccattcctcaaaccaagtttaaaacaactggcctcgacgaaggcattgaa
tacgaatttagagtctccgcacagaacattgtgggcatcggcaagccaagtaaagtgtca
gaaagctacgtagcccgtgatccatgtgatccaccaggaaggccagagccaatcactgtc
acaaggaattctgtgactcttcagtggaagaaacccacatatgatggtggaagcaaggtc
actggttatattgttgagaagaaagaactgcccgagggccgctggatgaaagccagtttt
acaaatgtcattgacactcagtttgaagtaactggcctagctgaagatcacagatatgag
ttccgggttatagctcgaaatgctgcaggagtgtttagcgagccttcagaaagcacagga
gcaataacagcaagagatgaggtagaaccaccacgaattcgtatggatccaaaatacaaa
gacacaattgtggttcacgctggtgagttattcaacattgacacagatatttatggcaaa
ccagtaccagccactcagtggataaaaggtgatcaggagctttcaaatacagctcgatta
gaaataaagagcactgattttgccaccagtctcaatgtaaaggacgcaatacgtgttgac
agtggaaattacacactgaaagccaaaaatgttgcaggagaggtatcagtcactgtaaat
gtcaaagttcttgacagaccagggccacctgaaggacctattgttatatcaggagttaca
gcagaaaaatgcacactcgcttggaaacccccactacaagatggtgggagtgatatcata
aattatattgtggaaaagagagaaaccagccgcctggtttggactgtggttgatgccaac
gtgcaaactctcagctgcaagcttactaagcttcttgaaggcaatgaatatatcttccgt
ataatggctgtcaacagatatggtgttggcgaacctcttgaatctgagccagtaattgtc
aagaatccattcgtagtgccagatgcaccaaaagctccagaaatcacagcggtgaccaag
gactcaatggttgttgtatgggaaaggccagcatctgatggtggcagtgaaattcttgga
tatgttcttgaaaaacgggataaagagggcatcagatggacaagatgccataaacgtctg
attggcgaactgcgcttgagagtaactggactcttagaaaatcacaattatgaattcaga
gtctcagctgagaatgctgctggactcagtgagccaagcccaccttctgcttaccaaaag
gcttgtgatcctatttataaaccaggacctccaaacaatcccaaagtcattgatactacc
agatcttccgtcttcctttcttggggcaaaccaatatatgacggtggctgtgaaatccaa
ggatacattgttgaaaaatgtgacgtgagtgttggtgaatggacaatgtgcactccaccg
actggaatcaataaaacaaacatagaagtcgagaagctgtcggaaaagcatgagtacaac
ttccgtatctgtgctgttaacaaagctggagttggagaacatgccgacgtccctggacct
attatagttgaagaaaaattggaagcaccagacattgatcttgacctagaactaaggaaa
attataaatataagggcaggcggctccttaaggttatttgttcctattagaggtcgtcct
acaccagaagttaaatggggaaaggtggatggtgaaatccgagacgcagctataatcgac
agcactagcagcttcacctctcttgttcttgacaatgtcaaccgatatgatagtggaaaa
tatactctcacgttagataacagcagtgggacaaagactgcctttgttactgtgagagtc
ctggacacaccaagtccacctgttaatctgaaagtcacagaaatcaccaaagactcagta
tcaattacatgggaacctcctttgttggatgggggatccaaaattaaaaattacattgtt
gagaaacgtgaagccacaaggaaatcatacgctgcagttgtcacaaattgccataagaat
tcttggaaaatcgatcaactccaagaaggttgcagttactactttagagtcacagctgag
aacgagtatggtattggccttcccgcccatactgatgatccaattaaggttgcagaagtc
ccacaacctccaggaaaaataaccgtgggtgatgtcaccagaaacagtgtctctttgagc
tggacaaagcctgaacacgatggcggcagtaaaatcattcagtatatcgtggaaatgcaa
gctaaacaccatgagaaatggtcagagtgtgctcgagtcaagtcccttgaagccgtaatt
accaacctaactcagggagaagaatacctttttagagttgtggctgtaaatgaaaaggga
agaagtgatcctaggtctcttgcagttccaatagttgccaaagatctggtcattgagcca
gatgtaagacccgcatttaacaattacagtgtacaggtcggccaagatttgaaaatagaa
gtgccaatttctggacgtccgaagccaaccattacctggactaaagacggtcttccactg
aagcagactacaagaatcaatgttactgattcacttgacctcaccatactcagtattaaa
gaaactcataaggatgacagtggacattatggaatcacagttgctaatgttgttggtcag
aagacagcatccatcgaaattataaccctagataagcctgatcctccaaaaggacctgtt
aaatttgatgaagtcagtgctgaaagtattaccttatcttgggaacctccactgtataca
gggggctgccagatcactaactacatagttcagaaaagagatacaaccaccacagtatgg
gatgttgtttctgctactgttgccagaactacactcaaagtgaccaaactgaagactggt
acagaataccaattcagaatattcgctgaaaacagatatggacaaagctttgccttggaa
tctgagccaactgtagctcaatatccctacaaagaaccaggccctccaggcacaccattt
gtcacagccgtttccaaagactccatggttatacagtggcatgaaccaatcaataacgga
ggaagcccaatcataggttaccaccttgagagaaaggaaagaaatagtattttgtggaca
aaggtcaacaaaactattattcatgacacccagtttaaagcactcaatcttgaagaaggc
attggatatgaattcagagtttatgctgaaaatattgtcggtataggcaaagcaagcaag
aattctgaatgctatgtagccagagatccctgtgacccaccaggaaccccagaagcaata
atagttaaaagacatgaaatcactttacaatggaccaaaccagcatacgatggtggaagt
atgattacgggttacattgtagagaaacgtgatttgcctgagggtcgttggatgaaagcc
agcttcacaaacgtcattgaaactcaatttactgtgtcaggtcttactgaagatcaaaga
tatgaattcagggtcattgcaaagaatgcagctggtgtaataagcaaaccctccgacagt
actgggccggtaaccgccaaggatgaggtcgaactcccaaggatttcaatggatccaaaa
ttcagagacacaattgtggtaaatgctggagaaacattcaggcttgaagctgatgtccac
ggaaagccgctacccaccattgagtggttaagaggagacaaggaaattgaagaatctgct
agatgtgaaataaagaacacagatttcaaggctttacttattgtaaaggatgccattaga
atcgatggtggacagtatattttaagagcttccaatgttgcaggttctaagtcattccca
gtgaatgtaaaagtgttagatagaccaggacctccagaagggccagtccaggttactgga
gtcaccgctgaaaaatgcacactaacgtggtctccaccacttcaagatggtggcagcaac
atttctcactatgttgttgaaaagagagaaacaagtcggcttgcctggactgttgttgct
tcagaggttgtaaccaattctctgaaagttaccaaactcttagaagggaatgaatatatt
ttccgtataatggctgtcaacaaatacggtgttggagagcctttggaatctgcaccagta
ctcatgaaaaatccatttgtgcttcctggaccaccaaaaaccctggaagtcacgaacatt
gccaaggactccatgaccgtctgttggagccgtccagatagtgatggtggaagtgagatt
attggctacattgtagaaaaaagagacaaaagtggcattaggtggataaaatgtaataaa
cgccgcattacagatttgcgtctaagagtaacaggattaacagaagaccatgagtatgaa
ttcagagtctctgcagaaaacgctgctggagttggagaaccaagtccagctacagtttat
tataaggcttgcgatcctgtgttcaaacctggcccccccatcaatgcacacattgtagac
accactaaaaattcaattacacttgcctggggtaaacccatctacgatggtggcagtgag
atcctgggatatgtagtagaaatctgtaaagctgatgaagaagaatggcaaatagttact
ccacagactggcctgagagccactcgatttgaaatttcaaaactcactgaacaccaggag
tataaaatacgagtctgtgccctcaataaagttggtttaggtgaggctacatcagttcct
ggtactgtgaaaccagaagataaactcgaagcacctgaacttgaccttgactctgaatta
aggaaaggaattgttgtaagagctggtggatctgtcagaattcacattccattcaaaggt
tgcccaacacctgagatcacttggtctcgagaggaaggtgaattcacagataaggtccaa
actgaaaaagcagcaaactatacccaactatcaatagataactgtgatagaagtgatgct
ggaaaatatactctcaagctggaaaacagcagtggatctaaatctgcctttgtaactgtg
aaggttctcgacaccccaggaccaatacagaatttggcagtcaaagaagtgagaaaagat
tttgtccttctgatatgggaaccacccatcattgacgggggtgcaaaggtcaagaactat
gttattgacaaacgtgagtcaaccagaaaagcatatgctaatgtgagtaataaatgcagc
aaaacaagctttaaagttgagaatcttacagaaggagccatgtactactttagagtaatg
gctgaaaatgaatttggagttggtgttccagtggaaaccgctgatgctgtgaaagcagct
gaacctccttccccaccaggaaaggtcacactcactgacgtgtcccagactcgtgcatcg
ctgatgtgggagaaacctgaacatgatggtggtagcagaatcctggggtatgttgttgaa
atgcagcccaaaggaacagaaaaatggagtgttgtggctgaatccaaagtctgcaatgca
gttgttactggtttgagttctggacaagaatatcagttctgtgtcaaggcttacaacgag
aaaggaaaaagcgatccaagagtgcttggtgttcctgtcatagccaaggacttgactata
cagcctagttttaagttaccatttaacacatatagtgtccaagctggagaaggtcttaaa
atcgaaattcctgtcatcggccgaccgagacctgaaatttcatgggtcaaagatggcgag
cctcttaaacagacaacaagagtaaatgttgaggaaacagctacatcaactattttgcac
attatagaaagtaacaaagatgactttggaaaatacaccataacagcaacaaatagtgca
ggtacggcaactgaaaatctcagcattatcgttctggaaaagcctggacctccagttgga
ccagttcggtttgatgaagttagtgcagactttgtggtcatatcttgggaacctccagcc
tatactggtggctgccaaataagcaactacattgtagagaagcgagatacaactaccacc
acttggcacatggtatcagcaacagttgcaagaacaacaattaaaataaccaaactgaaa
acaggcactgagtaccagtttaggatttttgcagaaaacaggtatggaaaaagtgccccc
ttggattctaaaccagttattgtacaatatccatttaaagaacccggaccacctggcact
ccttttgtgacatcagtctcgaaagatcaaatgcttgtgcagtggcacgagccagttaat
gatggaggcagcaaagttactggctaccatcttgaacagaaagaaaagaacagcatttta
tgggtcaaattaaataagactcccattcaagacaccaaattcaaaacaactgggcttgat
gaaggccttgagtatgagttcaaagtttctgctgaaaatattgttggcatcggcaagccg
agcaaagtgtcggaatgctttgttgctcgtgatccgtgtgacccaccaggtcgccctgaa
gccattgttattacaagaaacagtgtcacactgaaatggaagaaacctgcctatgacggt
ggcagcaaaataacaggttatactgtagaaaagaaagatctacctgacggccgttggatg
aaagccagctttactaatgtattagaaaccgaatatacagtgagtggacttgtagaagac
caaagatatgaattcagagtaattgcaagaaacgcagctggcaactttagtgaaccatct
gaaagcactggcgccattactgcaagagatgaaattgatgcaccaaatgcctcactggat
cccagatataaagatgtcatcgttgttcacgcaggagagacttttgtccttgaagctgat
atccgtggcacacctatacctgatattgtttggtcaaaagatggaaaagagcttgaagaa
acagctgccaggatggaaattaagtctactattcagcaaacaactcttcttgtcaaagac
tgtatacgtagtgacggaggacaatatatcctgaaactcagcaacgtgggtggaacaaag
tctataccaatcactgtaaaggtacttgacaggccagggcctcctgaagggcctctgaaa
gtttctggagtgactgctgaaaaatgttacctggcatggaacccacctttacaagatggt
ggtgctaatatctcacattacatcattgaaaagagagagacaagcagactctcctggacc
caggtttcaactgaggtacaggcccttaactacaaagtcactaaacttcttcctggtaat
gagtacattttccgtgtcatggctgtgaataaatatggaattggagagcctctggaatct
gagcctgttgtagcccgtaatccttataaaccaccaggtcctccttccccacctgaagcc
tcagcaatcaccaaagagtctgtcgtcgtaacatgggcacgcccagtggatgatggaggt
gctgaaatcgagggctacattcttgaaaaacgagataaggcaggcatcaggtggaccaag
tgcaacaagaaaacactaacagatcttcgattcagggtaactggccttactgaagggcat
tcctatgaattccgagttgctgctgaaaatgcagctggtgtgggtgaacctagtgagcca
tctgttttctatcgtgcatgtgatgccctgtatccaccaggaccaccaagtaatctaaaa
gtggcagacacttccagatcttctgtctccctggtgtggaataagccaatttatgatggc
ggcgctcccgttaagggctatgttgttgaggtcaaagaagccactgctgctgaatggaca
atgtgcactccaccaacaggattacaaggaaagcagttcaccgtgaccaagcttaaagaa
aatactgaatataacttccgtatttgtgccatcaattctgaaggcgtaggtgaacctgca
actatacctggttcagttgttgctaaagagaggcaagagccaccagaaatagaactggat
gctgatctccgaaaagtggtcattctgcgtgcgagtgctactttacgcttatttgtcact
atcaaaggtcgaccggaacctgaagttaaatgggaaaaggcagaaggcattctcactgac
cgggcccagattgaggtgaccagctcatatacaatgttggtaattgataacgttaccaga
tttgacagtggtcggtataatctgacactagaaaataacagtggctctaaaactgctttt
gttaacgtcagagttctcgactcaccaagtgcccctgtgaatttgaccgtaggagaagtg
aagaaagattcagtgacactggcttgggaaccaccgcttattgatggcggagctaagatt
acgaactacatcgttgaaaaacgagaaactacaagaaaagtgtacgctactgttacaaac
aattgcacgaagaacacttttaagattgaaaacctgcaagaaggatgttcttactacttc
caagtcttggcttccaatgaatatgggattggtttgccagctgaaacaactgaacctgtt
aaagtttctgaaacacccctcccacctggaagagtaactcttgttgatgtgacccgtaac
acagctacaattaagtgggagagaccagaaagtgatggtggcagcaaaattaccggttat
gtagttgaaatgcagaccaaagggagtgaaaaatggagcatgtgcacacaagttaagact
ctagaagcaactatatctggcctaactgctggagaggagtatatcttcagggtagctgca
cttaatgaaaaaggaaaaagtgatccaagacaacttggagtgccagtaattgcaagagat
attgaaataaagccttcagttgagcttcctttcaatactttcaatgtaaaggctacagac
caactgaagattgatgttccatttaaaggaagacctcaagctactgtaagctggaaaaaa
gatggtcagactcttaaagagacaactagagtaaatgtttcttcttcaaagactgtaaca
tcactaacaattaaggaagcttcaagggaagatgttggaacttatgaattatgtgtttca
aacagtgctggatccgtaacagttcctattactataattgtgcttgacaaaccaggacct
cccggacctatacatattgacgaggttagttgtgacaatataaccatttcttggaatcct
ccagaatatgatggcggctgccagattagcaattacatcgttgaaaagagagaaacctct
tctacaacatggcacgtagtttcacaggcagttgcaagaacatccattaaaatagttcgt
ctagtaacaggaagtgagtatctgttccgtgtttgtgcagaaaaccgctacggaaagagc
tcctacagtacatcttcagctgtagttgcagagtatccattcagccccccaggtcctcct
ggtactcctaaagttgtgcatgccacaaaatccaccatgttggtaacctggcaagtgcca
gttaatgatggaggaagtcaagtacttggctatcaccttgagtataaagaaagaagcagc
attctttggtcaaaagcaaataagagcctcatcactgctactcaaagcaaagtctccggc
cttgatgaaggactgatgtatgagtatcgtgtatatgctgagactattgctggaattggt
aaatgcagtaagtcttgtgaaccagtccctgcaagagacccttgtgaccctcctggacaa
cctgaagtcacaaatatcacaaggaaatcagtgtcacttaaatggtctaagccacattat
gatggtggagctaagatcaccggatacattgttgaacgtagagaactaccagatggccgg
tggctgaagtgcaactttactaacgtacaagaaacatactttgaagtaaccgaacttact
gaagaccagcgttatgaattccgggttttcgcaaggaatgctgctgactcaactagtgag
ccatctgaatccactggacctatcacagttaaagacgatgttgaggctccaagaattatg
atggatgtcaagttccgagatgttattgttgtcaaagctggagaggtccttaagataaat
gcagacattgcagggcgacctctgccagtaatttcctgggccaaggatggtgtagaaatt
gaagagagagcaagaacagaaattgtctcaacagattacaatactttgctaacagtgaaa
gactgtgtccgacgagactctgggcagtatgtgctaacactgaagaatgttgctggaact
cggtcttttgcagttaattgcaaggtacttgataagcctggcccaccagcaggaccactt
gaaataactggcctcactgctgagaaatgctctgtttcttggggaccgccccaagaagat
ggtggcgcagctatcgactattacattgtagaaaaacgcgagacaagtcgccttgcttgg
acaatatgtgaaggagagttaaggacaacatcctgtaaagtgaccaagttgctcaagggc
aatgaatacatctttagagtaaccggtgttaataaatatggtgttggcgagcccctggag
agtatggctgtaaaggcactagatccatttacggttccaagtccacccacatctttggaa
attacatctgtgaccaaagagttcatgacactttgctgggcaagaccagagagtgatgga
ggcagtgaaatctctggatacataattgaaaggcgagagaagaacagcctacgatgggtg
cgtgtaaacaaaaaaccagtttatgatctgagagtgaaatcaacaggacttcgggaagga
tgtgaatatgagtatcgggtatatgcagaaaatgctgcaggcctgagccttccaagtgaa
acctctcccttaattcaggcagaagatcccgtgttcttaccgtctcctccatccaaaccc
aatatcatggactcgggcaagaccaatataactattggctgggttaagcccttatttgat
ggtgggtccccagtaactggatacactgtagaatttaaaaaatctgatgaaactgactgg
aaaactgccattcagaacttaaggggcacagaatacacagtaagtggactaaccacagga
gccgaatacattttcagaataagatctatcaataaggtcggtgctagtgatcccagtgat
agctccgatccccagatagcaaaggaaagagaagaagaacctgtatttgatcttgacagt
gaaatgaagaagaccttgatcgtcaaggccggtgcctcctttaccgtgactgtgcctttc
cgaggaagaccagtacccagtgtctcctggagcaaaccagacactgacctccgcactaga
gcttatattgattccacagactctcatacatcactgactattgaaaatgccaatagaaat
gattctggaaaatacacattaacaattcagaatattttgaatgctgcttcactgacctta
gttgtcaaagttttagattctcctggtcctccagccaatattactgtacatgatgtcacc
agggagtctgcagtgttatcctgggatgttcctgaaaatgatggtggagcaccagtgaag
aattactacatagaaaaacgggaggccagtaagaaagcatgggtctcagtgaccagcaac
tgtaaccgcctctcccacaaaattaccaacttacaagaaggggagatttactacttcaga
gtctccggagaaaatgagtttggtgttggtgtaccagctgaaacgaaggaaggagtaaaa
ataacagaaaaaccaagcccacccgaaaaacttggagtaacaagtgtatccaaagatagt
gtttccctggcctggttgaagccagaacatgatggtggaagcagaattgtacattatgtc
attgaagcactagaaaaaggacagaaaaattgggtgagatgtgcagtggtaaagtcaacc
catcatgtcatttctggtctgagggagaattctgaatactttttccgggtgtttgctgaa
aatcaagctggtctgagtgacccaagagagcttctgcttcctgtccttgtaaaggagcag
ctagaaccacctgaaattgacatgaagaacttcccaagtcataccgtctatgttagatct
ggttcaaaccttaaagttgatattccaatttctggaaaaccactgcccaaagtgacctta
tcaagagatggtgtcccgctgaaagcaaccatgagatttaacactgaaattactgctgag
aacctgaccatcaatctcaaagaaagcattgctgctgatgctggaagatatgagatcact
gctgccaactccagtggaacaaccaaagctttcattaacatcatcatactggacaggcct
ggtcccgcaactggccccgttgtgattagtgatgtaactgaagagagcgtgactctcaaa
tgggagccacctaagtatgatggtggaagtcaggttaccaattacattgtactcaagaga
gagacaagtactgcagtatggactgaagtgtctgcgacagttgcaagaaccatgattaaa
gtcatgaaactgaccacaggagaagaataccaattccgcatcaaggcagaaaaccgcttt
ggcatcagtgatcacatagattcggcttgtgtggttgtcaaactaccatacacaacacct
ggaccgccatctacaccatgggtcactaaagtcactcgagaaagtatcaccgtgggctgg
catgaaccagtgtccagtggaggcagtgcagttataggctatcacctggaaatgaaagac
agaaacactatcttatggcagaaagccaacaaaatggtcatccgcaccactcacttcaca
gtcacaaccatcagtgctggacttgtctatgaattcagggtgtatgcagaaaatgctgct
ggtattggaaaacccagccatccttcagaaccagtcctagccattgatgcctgcgaaccc
ccaagaaatgtccgtatcactgatgtttcaaagaactctgtcaacctttcatggcaacaa
ccagcttatgatggaggaagcaagattacaggctacattgttgagagacgagaccttcca
gatggcagatgggccaaggccagcttcaccaacgttaccgagactcaactcactgtctct
ggcttgactcagaattcccagtatgaattccgtgtctttgctagaaatgctgtcggttcc
atcagcaatccatccgaggttgcaggccccattacatgcatcgattcttatggtggaccc
gtaattgatttgcctctagaatatacagaagttgtcaaatacagagcaggtgcatctgtg
aagctcagagctggcatttctggcaaacctgagcctacaattgagtggtataaagatgat
aaagagttacaaaccagtgcactggtgtgtgtcgaaaataccactgaccttgcagctata
ctcatcaaagatgcaactcgccttaacagtggaagctatgaattaaaactaaggaatgcc
ataggctcagcctcagccaccatcagagtgcagatccttgacaaaccaggacctccaggt
ggaccaattgaatttaagaccgtcactgctacaaagataactcttctctggcagcctcca
gcggatgatggcggtgcaaaagtcactcactacatcgtggaaaagcgtgagacaagccgc
gtcgtgtggtctatggtgtctgaaaatttggaagagtacatcattacgaccaccaaaatt
atcaaaggaaatgaatacatcttccgggttcgcgctgtgaacaaatacggaattggtgat
gcactggaatctcacccggtggtagcaaagaatgcatttgtcacacctgggcctccgagc
gtgccagaggtgacaaagataaccaagaattcgatgactgttgtctggaacaggccagtt
gcagatggtggtagtgacataagcggctatttccttgagaaacgagacaagaagagtctg
ggatggtttaaagtcctaaaggagactatccgtgacaccagacagaaagtgacaggactc
acggaacacagtgactatcaataccgagtttgtgctataaatgctgctggacagggtcca
ttttctgaaccatctgacttctacaaagctgctgatcctattgatcctccaggcccaccg
gctaagataagaattgaagattcaactaaatcatccatcactcttggctggagtaaaccg
gtctacgatgggggcagtgctgttactggatatgttgttggcatgagacaaggagaggaa
gaggaatggactgttgtctctacaaaaggagaggtcagaactacagagtatgtggtgtct
aacctgaaacctggagtcaattactacttccaggtatccgctgtaaactgtgccggacaa
ggggaacctatagaaatgactgaacccgtacaggccaaagatatacttgaggaaccagag
atcgacctagatgtggctttcaggacctccattatagctaaagccggtgaagacgtacaa
gtgttgattcccttcaaaggcagacctccacctactgtcacatggagaaaagatgagaag
aatcttggcagtgatgccagatacagcattcaaaacactgattcatcttcattactcact
attcctcaagtcactcgcaatgatacgggcaaatatattctcacaatagaaaatggcgtt
ggtcagccaacgtcttcaactgtgagcgttaaagtgcttgatacaccagctgcctgccag
aaactacagattaaacatgtttctcgaggcacagtcacattgctctgggagtctcctctc
attgacggaggatctcccataattaactacatcattgagaagaaagatgccaccaagaga
acatggtcttcagtgtcacacaagtgttctagcacatcctttaaggtaacagatttgtca
gagaaaactccattcttcttcagagttcttgcagaaaatgaaattggaatcggggaaccc
tgtgaaactacaaagccagtgaaggctgccgaagtaccagctcctatacgcgatctctca
gtgaaagactcaacaaaaacatctgttaccctgagctggaccaagcctgactttgatggt
ggtagtgtcatcacagattatactgtggaaaggaaaggtgaaggcgaacaaacatggtca
catgctggcgtaagtaagacatgtgaaattgaggttagccaactcaaggaacattcagtc
ctggaattcagagtgtctgccagaaatgagaaaggactgagtgatggcgtcactattggg
ccaattacagtgaaagaacttgtaattccaccgcaagttgacctgtcagaaatccctggg
gcccaagtcactgtgagaattgggcataatgtgcacctcgagttaccttataaaggaaaa
cctaaaccatctatcagttggctgaaagacagtttgccgttgaaagaaagcgaacgtgtt
cgtttgagtaaaactgaaaacaaacttactttgagtattaagaatgcaaagaaggagaat
ggagggaaatacaccattattctcgataacgcagtttgtcgaaactcatttcccatcaca
atcatcacactcggcccaccatcaaagcccaaagggcccattcgatttgatgaagtcaag
gctgacagtgtcatcatatcatgggatgtgcccgatgatgatggaggaggagaaattacc
tgttacagcattgagaagcgagaagcttcacaaactaattggaagatggtgtgttccagt
gttgcccggacaactttcaaagttcctaatctagtcaaagatgctgaataccagtttaga
gttagggcagaaaacagatatggagtcagccagccacttgactcaaacatcattgtggca
aaacaccagttcaggattcctggccccccaggaaagccagttacatacaatgtgacttct
gatggcatgtccctaacttgggatgctccagtttatgatggcggttcagaagttactgga
taccatgttgaaaagaaagaaagaaatagcatcctgtggcaaagaattaacacatcacca
atatctggaagagaacatagagctactggactaatggaaggcctggattaccagttccgt
gtatacgctgaaaattctgccggcctaagctcacctagtgacccaagcaaatttacctta
gctgtttccccagtagacccacctggcactcctgactacattgatgtcacccgggaaacc
atcactctgaaatggaacccaccactgcgtgatggaggcagtaagattgtggcctacaac
atcgagaaacggcaagggagcgatcactggaccagatgcaactttagtgatgtcagcgaa
tgccagtacacggcaacaggacttagtcctggcgatcgatatgagttcagaatacttgca
agaaacgctgttggaaccataagcccgccctcacagtcttctggcgttattatgacaagg
gacgaaaatgttgcaccaattgtagagtttggccctgagtactttgatggtgtcactatt
aagtctggagagagccttagaattaaagctttggtgcaaggacggccagtacctcgagta
acttggttcaaagatggagaagaaattgagaagaggatgaatatggaaataactgatgtc
cttggatccaccagcctctttgttagagatgctactcgggaccatcgtggtgtatacaga
gtggaagccaaaaatgcatctggctccacaaaagcagaaattacagtgaaagtacaagat
acaccaggaaaaccagttgggccaataagattcaccagtataaccggcgagaagatgacc
ttgtggtgggatgctccactcaatgacggctgtgctcccgtatcgcactacatcattgaa
aaacgggaaaccagcagacttgcttgggcgctaattgaggataattgtgaagccctcagc
tataccgccactaaactaataactggcaatgaataccaattccgtatttctgcagtcaac
aagtttggtgttggcaggccactggattctgacccagtggttgctcaaatacagtacact
actcccaattcccctggcactccagaacctagcaatgtaacaggcaatagcattaccctg
acatgggcaaggccagaatcagatggtggcagtgaaattcaacagtacatccttgaaagg
agagaaaagaaaagcacacgatgggtgaaagtgatcagcaaacgaccaatctctgagaca
agattcaaagtcaccggtctgacagagggcaatgagtatgaattccatgtcatggctgaa
aatgctgcaggagtaggacctgcaagtggtatctcaagactaatcaaatgtagagagcca
gtcagcccaccaagtgctcccactgtggtcaaagtgacagacacatcaaagacaactgtg
agcttagaatggtctaagccagtgtttgacggagggatggagataattgggtatattatt
gaaatgtgcaaagctgacttaggagactggcacaaggtgaatgcagaaggatgggtgaaa
acaagatatacagttactgatctacaagcaggtgcagaatacaaattccgggttagtgct
gtcaatggtgctggaaaaggagacagctgtgaagtgaccggcaccattaaagcagttgac
cgattatcagctcctgagttagacatcgatgccaacttcaagcagactcatattgtgaga
gctggggccagtattcgcctcttcattgcctatcagggtagaccgactccgacagctgtg
tggagcaaacctgactctaaccttagcattcgggctgatatccatacaacagactccttc
agcaccctcaccgtggaaaactgcaaccgaaacgacgcagggaaatatacccttactgtg
gaaaacaacagcggtagtaagtcaatcacattcaccgtaaaggtgctagactctccaggc
ccacctggcccaattaccttcaaggatgtgacccggggatctgttacattgatgtgggat
gcccctctccttgatgggggtgcccgaatccatcactacgtggtagagaaacgagaagcc
agtcgccgtagttggcaggtagtcagtgaaaaatgcactcgtcagatcctcaaggtcaac
gacctggtagaaggcgttccatactatttccgtgtttctgcagaaaatgagtatggtgtt
ggtgaaccctatgaaatgccagaaccaatggtagccacagaacagcctgctccaccaaag
agacttgatgtcattgacacaagcaaatcctctgtggtcttagcttggcttaaacctgac
catgatggaggcagccgaatctctggctacctgctcgaaatgagacaaaagggatctgac
ttctgggttgaagctggtcacaccaaacagctgactttcacggtggagcacctcactgag
aacactgaatatgaattccgcgtgaaggccaagaatgatgctggctacagtgaacccagg
gaagccttctcttctgtcatcatcaaggagcctcaaattgagcccacagctgatctcact
ggaattaccaatcagctcataacttgcaaagcaggcagcacgtttaccatcgacgtgcca
atcagtggtcgtcccgcccccaaagttacatggaagcttgaagaaatgagacttaaggag
acagatcgagtgagtatcacaacaacaacagacagaaccaccctgtctgtaaaggacagc
atgagaggtgactctggaaggtacttcctgaccctggaaaatacagctggtgttaaaaca
tttaccatcacagttgttgtcattggaaggccaggtccagtaactggccccattgaagcc
tcatctgtctcagctgaatcatgcatcctgtcatgggctgaacctaaagatgacggaggc
accgatattactaattacatagttgaaaagcgtgagtcaggtacaacagcttggcagctt
gtcaattccagcgtcaagcgcactcagattaaagtcactcatctcacaaaatacatggaa
tattctttccgtgtcagttcagagaacagatttggtgtcagcaagcctctggaatcagca
ccaatcgttgctgagcatccatttgtcccaccaagtgcacctaccagacctgaggtctac
catgtgtctgccaatgccatgtctattcgctgggaagaaccctatcatgatggtggcagt
aaagtcatcggctactgggttgagaagaaagaacgtaacaccattctttgggtgaaagaa
aacaaactgccatgcttagagtgcaactacaaagtgaccagtttggtggaaggactggag
tatcagttcagaacgtacgcactcaatgccgcaggcgttagcaaagccagtgaagcatca
agacctatgatggctcaaaacccagttgatgcaccaggaagaccagaggtgacagatgtc
accagatcaacggtgtcactgatttggtctgccccagtgtatgatggaggcagcaaagtt
gtaggctacatcatagagcgtaagccagtcagtgaagttggagatggtcgctggctcaag
tgcaactacaccattgtatctgacaatttcttcaccattactgctctcagtgaaggagac
acttatgaattccgtgtgttggccaagaatgcagcaggcgtaattagcaaaggatcagaa
tctacaggccccatcacttgccgagatgaatacgctccacccaaagccgaactcgatgcc
agattacagggtgatctggttaccatcagagcaggctcggatcttgttctcgatgctgca
gttggtggcaaacctgaacccaaaattatctggaccaaaggggacaaggaactagatctc
tgtgaaaaagtctctctgcagtacactggcaaacgagcaactgctgtgatcaagttctgt
gacagaagtgacagtggaagatacactttaacggtgaagaatgccagtgggaccaaggcc
gtgtctgtcgtggtcaaagttctcgattccccgggcccatgtggaaagctcaccgtcagc
agagtaacagaggagaagtgcactttagcctggagccttcctcaggaagatggaggtgca
gaaataactcactacatcgtggaaagacgcgagactagcagactcaactgggtgattgtg
gaaggcgaatgcccaaccctatcctatgtggttaccagactcatcaagaacaacgaatac
atattccgagtgcgggcagtaaacaaatatggccctggtgtgcctgttgaatcagagccc
attgtcgccagaaactccttcactattccatcacaacctggcatacctgaagaagttggg
gctggcaaagagcacatcatcattcagtggacaaaacctgaatctgacggtggcaacgag
atcagcaactatctagtagacaaacgtgagaagaagagcttgcgctggacacgtgtgaac
aaagaccatgtggtgtatgataccaggctgaaggtgactggcctgatggaaggttgtgat
taccagttccgggtgaccgcagtaaatgctgctggtaacagcgaacccagcgaagcttcc
aacttcatctcttgcagagaaccatcatatacccctggaccaccttctgctccgagagtt
gtagataccaccaaacacagcattagtttagcctggaccaagcccatgtacgacggtggc
actgacatcataggatatgttcttgaaatgcaagagaaggacactgaccagtggtaccga
gtgcataccaacaccacaataagaaataatgaattcactgtgacagaccttaaaatgggc
cagaaatactccttcagagtcgctgctgtgaacgtgaagggcatgagtgaatacagcgag
tcaactgctgaaattgagcccatggaaagactagaaataccggatcttgagcttgccgat
gatttaaagaagattgtgaccatcagagctggggcctcgttgcggctgatggtgtctgta
tctggaagaccaccacccgtcatcatatggagcaagaagggcattgaccttgcaagccgg
gcgatcattgacaacactgagagttactctttacttattgtggacaaagttaaccggtat
gatgctggaaaatacaccattgaagctgaaaaccaatctggcaagaaatcagcaactgtc
cttgttaaagtatatgatactcctggtccctgtccttcagtgaaagttaaggaagtatca
agagattctgtgaccattacttgggaagttcccacaattgatggtggagctcctgtcaac
aattacattattgagaagcgtgaagctgccatgagagcattcaaaacagtaactaccaaa
tgcagcaagacgctctacagaatttctggacttatagaaggaaccatgtactatttcaga
gtgctgccagaaaatatttatggcattggagaaccctgtgaaacatctgatgcagttctg
gtctcagaagtacccttggtgcctgtgaagctagaagttgtcgatgtcaccaaatcaact
gttacccttgcctgggagaaaccactctacgatggtggtagccggctcactggctatgtt
cttgaggcctgcaaagctggcaccgagagatggatgaaggttgtcaccttaaaacccaca
gtcctagagcacactgttatttccttaaatgaaggtgaacagtacttatttagagtaagg
gcacaaaatgagaaaggtgtgtcagaaccaagagagatcatcacagccgtgactgtacaa
gacctcagagtgttgccagcaatcgatctttctacaatgcctcaaaagaccatccacgtc
ccagccggcagaccagtagagctggtgataccaatcgctggtcgcccacctcctgctgct
tcctggttctttgctggctctaaactaagagaatcagagcgtgtcgcagttgaaactcat
actaaggtagctaaattaaccattcgtgaaaccactatcagagatactggagactatata
cttgaactgaagaatgcaaccggaactacttcagagaccattaaagttatcattctcgac
aagcctggtccaccaactgggcctgtcaagattgaagaaattgatgctacttcagtgacc
atttcctggggaccgcctgaactggatggtggtgctccactgagtggctacgtggtagaa
caacgtgatgcccaccgtccagggtggctgccagtgtctgaatcagtgactagaccaaca
tttaagtttaccagactcactgaaggaaacgagtatgtgttccgtatcgctgtgacaaac
cgcttcgggatcggctcgtacttgcaatctgaggtcatagaatgtcgcagccgcatcaat
attcctggacctccagaaacattacagatatttgatgtctcacgtgagggcatgacactt
acttggtacccaccagaagatgacggtggctcccaagtgactggatacattgtggagcgc
aaagaagtgagagtagatcgatgggtccgtgtaaataaagtaccagtgacgatgacacgg
taccgttccactggccttactgaaggcttagaatatgaacaccgtgtcacagccattaac
gtgagaggaactggaaaaccaagccgtccttccaaacccaccattgccatggatccaatt
gctcctccaggaaagccacaaaacccaagagttactgatacaacaaggacatcagtctcc
ctggcctggagtgttccagaagatgaaggaggatctaaagtcacaggctacttgatcgaa
atgcaaaaagttgatcaatatgaatggaccaaatgcaacaccaccccaaccaagattcgg
gagtatactctcacacacctacctcagggcgctgaatacagattccgtgtcctagcttgt
aacgctggtggacctggggagcccgctgaggtaccaggaacagtcaaagtcacggaaatg
cttgaatatcctgactatgaacttgatgaaagataccaggaaggtatctgtgtaagacaa
ggtggggtcatcagacttaccataccaatcaaaggaaaaccattcccaatatgtagatgg
accaaggaaggccaagatattagtaagcgtgccatgattgcaacctctgaaactcacact
gagcttgtaatcaaagaagcagacagggatgattctggcacttacgacctggttctggaa
aacaaatgtggcaagaaggctgtctacatcaaggttcgggtgataggaagtcccaacact
ccagaaggaccacttgaatatgacgacatacaagctcgctctgtaagggtcagttggaga
ccccctgccgatgatggtggtgctgacatcttaggctacatcctcgagagacgagaagtg
cctaaagccgcctggtacaccatcgactccagagtccgaggtacatctctggtcgtaaaa
ggcctcaaagaaaatgtggagtaccatttccgcgtttcagcagaaaaccagtttggaata
agcaaacccttgaaatctgaggaaccagtcataccaaaaacaccactgaaccctcccgag
cctccaagcaatcccccagaagtactagatgtgaccaagagttctgtcagcctgtcctgg
tcccggcccagagacgatggtggttctcgggtcacaggctactacattgaacgcaaggag
acatcaactgacaagtgggtcagacacaacaagactcagatcaccaccacaatgtacacc
atcaccgggcttgttcctgacgcggaatatcagttccgcatcatcgcacagaatgacgtt
ggcctaagtgagaccagccctgcttctgaaccagttgtttgcaaagatccatttgataag
ccaagccaacctggagaactcgagattctttcaatatccaaagacagcgtcactctacaa
tgggagaaacctgaatgcgatggtggcaaagaaatccttggatactgggttgaatataga
caatctggagacaatgcctggaagaagagcagtaaggaccgcatcaaggacaggcaattc
acaatagggggtttgctggaagctacagagtatgaattcagggttttcgctgagaatgag
acagggctgagcagacctcgaagaaccgctatgtctgtaaagacgaaactaacatctgga
gaggccccaggagtacgcaaagaaatgaaggatgtcaccaccaaactgggtgaagctgct
caactctcatgccagattgttggaaggcctctaccagacattaaatggtaccgatttggt
aaggagctgatacaaagccgcaagtacaaaatgtcttcagatggacgcacacatactcta
acagtaatgaccgaggaacaagaagatgaaggcgtttatacctgcatagctaccaatgag
gttggagaagtagaatccagtagtaagcttctcctgcaagcaacgccacaattccatccc
ggttacccactgaaagagaagtattacggtgctgtggggtcaacgcttcgacttcacgtt
acatacattggccgtccagtacctgccatcacttggttccatggccagaaacttttgcaa
aactcagaaaacattgctattgaaaacactgagcagtatactcatctcgtcatgaagaat
atccaacgtaagactcacgctgggaaatacaaagttcagctcagcaatgttcttggaacg
gtggatgccatccttgatgtggaaatacaagataaaccagacaaacctacaggaccaatt
gtgattgaagctctattgaagaactctgtggtgatcagctggaaaccacctgcagatgac
ggaggctcctggatcaccaattatgtggtagagaaatgtgaggccaaggaaggggttgaa
tggcaattggtgtcttcagccatctcagtgacaacctgtagaattgtgaacctcacagaa
aatgctgggtattacttccgggtttcggctcagaacacgtttggcatcagtgaccctcta
gaagtctcctcagttgtgatcattaagagtccatttgaaaagccaggtgctcctggcaaa
ccaactattgctgctgtcacaaaagattcttgtgttgtggcctggaagccacctgccagt
gatggaggtgcaaagattagaaattactaccttgagaagcgtgagaagaagcagaacaag
tggattgctgtgacaaaagatgaaattcgagaaaccgtcttttcagtgcaaaaccttatt
gaaggtcttgaatatgagttccgtgtgaaatgtgaaaacctaggtggggaaagcgaatgg
agtgaaatatcagaacctgtcattcccaaatctgatgtcccaattcaggccccacacttt
aaagaggaactgagaaatctaaatgtcagatatcagagcaatgctactttggtctgcaaa
gtgactggtcatccaaaaccaattgtgaaatggtacagacaaggcaaagaaatcatcgca
gatggattaaagtacaggattcaagagtttaagggtggctaccaccagctcatcattgca
agcgtcacagatgatgatgccacagtttaccaagtcagagctaccaaccaaggagggtct
gtgtctggcactgcctccttggaagtagaagttccagccaagatacacttgcctaaaaat
cttgaaggcatgggagcagtccacgctctccgaggtgaggtaatcagcatcaagatccca
ttcagtggcaaaccagacccagtgatcacctggcagaaagggcaagatctcatcaacaac
aatggccactaccaagttattgtcacaagatctttcacgtcacttgttttccccaatgga
gtggagagaaaagatgctggtttctatgtggtctgtgctaaaaacaggtttggaattgat
cagaagacagttgaactggatgtggccgatgttcccgacccacccagaggagtcaaagtt
agtgacgtctcacgagattctgtcaacttaacatggactgagccagcttctgatggtggc
agcaaaatcaccaactacattgttgaaaaatgtgcgaccactgcagaaagatggatccgc
gtaggacaggcccgagaaacacactataccgtgatcaacttatttggaaaaacaagttac
cagttccgtataatagcagaaaataaatttggcctaagcaagccttctgagccttcagag
ccaaccataaccaaagaagataagaccagagccatgaactatgatgaagaggttgatgaa
acccgggaagtttctatgaccaaagcatctcactcttcaaccaaggaactctatgagaaa
tatatgattgctgaagatcttgggcgtggtcagtttggaattgtccaccgttgtgttgaa
acatcctcaaagaagacatacatggccaaatttgttaaagtcaaagggactgatcaggtt
ttggtaaagaaagaaatttccattctaaacatcgctaggcaccgaaatatcttatacctc
catgaatcatttgaaagcatggaagaattagttatgatctttgagttcatatcaggactt
gacatatttgaacgcattaacacaagtgcttttgaacttaatgagagagaaattgtaagc
tatgttcgccaggtctgtgaagcacttgagttcttacacagtcataatattggacacttt
gacattagaccagaaaatatcatttaccaaacaagaaggagctccaccattaaaatcata
gaattcggtcaggcccatcagctgaagccaggggacaactttaggcttctgttcactgcc
cctgaatactatgcacctgaagtccaccagcatgatgttgtcagcacagccacagacatg
tggtcactcggaacactcgtgtatgtgctgttgagtggtatcaatccattcctggctgaa
actaaccaacaggtaattgagaacatcatgaatgctgaatatacctttgatgaagaagca
ttccaagagatcagcactgaagccatggactttgttgaccggctgttagtgaaagagaga
aaatctcgcatgacagcatctgaggctctccagcacccatggctgaagcagaagatagaa
agagtcagtactaaagtgatcaggacattgaaacaccgacgttactaccacaccctgatc
aagaaagacctcaacttggttgtgtctgcagccaggatctcctgtggtggtgcagttcga
tctcagaagggagtgagcattgctaaagttaaagtggcatccattgaaatcggcccagtt
tccggacagataatgcatgcagtcgtcgaagaaggaggatatgtcaaatatgtatgcaaa
attgaaaattacgatcagtctacccaagtgacttggtactttggtgtcagacagctggag
aacagtgagaaatatgaaatcacctatgacgatggagtggccaccatgtatgtcaaagac
attaccaaattcgatgacggtacctacagatgcaaagtagtcaacgactacggggaagac
agttcttacgcagagctgtttgttaaaggtgtgagagaagtttacgactattactgccgt
agaaccataaagaaacttaagcgcagaacagataccatgagactcctggaaaggccacca
gaattcacgctgcctctctataacaggacagtttatgtgggtgaaaatgtccggtttgga
gtaactataactgtccacccagagcctcgagttacatggtataaatcaggtcagaaaatc
aaaccaggtgatgatgataggaagtacacatttgagtccgacaagggtctttaccaatta
accatcaacagtgtaactacggatgatgctgccgaatacactgttgttgcaagaaacaaa
tacggtgaagacagctgcaaagcaaagctgactgtgaccccacacccacctccaacaggt
acgaccctaagacccatgttcaaacggctactggcaaacgcagaatgccaagaaggccaa
agtgtctgctttgagatcagggtgtctggcatccccccaccaacattaaaatgggagaaa
gacggtcagccactgtccctcgggcctaacactgaaattatccacgaaggcttggattat
tacgctcttcatatcagggatacgttgcctgaagacacgggttactacagagtcacagcc
acaaacactgctggatccaccagctgccaggcccacctacaagtggaacgcctgaggtac
gtcaaacaggagttcaagactaaggaggagcgcgaacgacacgtacagaggcaaattgac
aagacgctgagaatggctgaaattctttccggaactgagactgtgccactgacacaggtc
gcccaggaggcactgagagaagctgccaccctttacaaaccagccgtcagcaccaagact
gtaaaaggggaataccgacttgagacggaagaaaagaaggaggagagaaaactccgcatg
ccttacgaagtaccagagccacgcaagtacaaaccggctgccatagaagaagaccaacac
attaagcagttcgtgcccatgtctgacatgaaatggtacaaaaagatacgcgatcaattt
gaaatgcctgggaagatggacagagttgtacagaaaagacccaagcgcatccgcctttca
agatgggaacagttctacgtgatgcctcttccacgcatcaccgatcaatacagacccaag
tggaggattcccaaactgtcccaagacgaccttgaaatggtgagaccagcccgccggcgt
acaccttctcctgattattacttttattacagacccaggagacgttctctcggtgacatc
tcggatgaagaattactcctgcccattgacgactacctggcaatgaagagaacagaggaa
gagaggctgcgtcttgaagaagagctggaactgggtttttcagcctcacccccaagccgg
agccctccacgttttgagctttcgagtctgcgttacccttccccacaagctcacgtcaag
gtggaggaagcaagaaaaggcttcagatactcaacgtatcacatcccaacgaaggcggag
acgagcacgagttacgcagagctgcgggagcggcacgcccgcacctggcacaggcagccc
aggcagcggcagaggatcatggccgagagagaggaccaagagctgctgcgtccagtcacc
accacccagcgcctctcggaatacaaaagcgagctggaccacatggcgaaggaagaaaaa
tctagaaggaaatcaagacgccagagagaagtgactgaaataacggaaattgaggaagaa
tatgagatctccaaacacgctcagagagacacttcctcctcggtgtccaggctgctgaga
cgccggcgctccctgtctccgacctacatcgagttgatgaggccggtatccgagctgatc
cggccgcggccacagccagctgaggaatatgaagatgaagaggacgtagaaagaaggtct
cctaccccagagaggactcgcccacgttcccccagccctgtgtctagtgagcgttcactg
tcaagatttgagaggtcggcaagatttgatatcttttccaggtacgagtccatgaaagct
gctttaaaaactcagaagacatcagaaaggaagtatgaggttttgagtcagcagcctttt
acgctggaccacatgcctcgaatcacactgaggatgcgctcccacagggtaccgtgcggc
caaaatacacgttttatcttaaatgttcagtctaagccaactgccgaggtcaaatggtac
cacaacggtgtagaactccaagagagcagtaagattcattacaccaacaccagtggggtt
ctgaccctggaaattctggactgtcatattgatgacggcggaacataccgtgccgtgtgc
accaactacaaaggtgaggcttctgactatgcaaccttggacgtcacgggaggggattac
accacctatgcttcccagcgcagagacgaagaggtcccccgatccgttttccctgagctg
acgagaacagaggcatatgcggtttcatcatttaagaaaacatctgagatggaagcttcc
tcttccgtcagggaaatgaaatcacagatgacagagacaagggaaagtctctcatcatat
gaacaccacgcatctgcagaaatgaaaagtgctgcagtcgaagaaaagtcgctggaagaa
aaatccacacacaggaagatcaagacgactttggcagcaagaattctcacgaagccaagg
tccataacggtgtatgaaggcgactctgcaaggttttcttgcgatacagatggtgagccg
gtaccgactgtgacatggctgcgtaggggacaagtcataagcacttccgcccgccaccaa
gtgaccaccgcaaagtacaaatcgacctttgagatctcttcagtccaggcttcggatgag
ggcaactacagcgtggtggtagagaacagcgaagggaagcaagaggcacagtttactctg
accattcaaaaggccagggttactgaaaaggctctgacatcaccaccgaaagtcaaatcc
ccagagcctcgggtaaaatccccagaaggagtcaagtctccaaaacaagtgaaatcccca
gaaccggtgacttctcacccaaaagctgtatcacccacagagataaaacccacaccaaca
gaaaaggttcagcagctgccagtcactgccccacccaagataattcagtccttgaaagca
gaagcttctaaagatatagcaaagctgacctgtgtggtcgaaagtactgtattgtgtgca
aaagaggtcgcctggtataaagatggtaagaaactgaaggaaaatgggcatttccagttt
cattattcggcagatggtacctatgagctcaaaatccataacctcactgaatctgattgt
ggagaatacatttgtgagatttctggtgaaggtggaacttccaaaactaacttccaattt
gtgggacaagcctttaagaatatccatgaggaagtttcaagcatatcagaaaccaagaaa
gcagctcagaaaactgctgtgtcaacagaaaccaagaaagcggctccgaaaactgctgag
ccaacagaaaccaagaaagcggctccaaaaactgctgagccaacagaaaccaagaaaact
gaaccaaaagctcctgaaccagtttccacaaaaccagtaattgttactgggctgcaggat
acaactatttcttcagacagtgtcactaaatttgcagttaaagctactggagaaccccag
ccaactgtcatctggacaaaggatggaaaggctataacacaaggaggtaaatataaactc
tctgaagacaaaggaggattcttcctagaaattcataacactgatacttctgacggtgga
ctttatacttgtacagtaacaaattcagctggatctgtgtcctctagctgcaaattaaca
ataaaagctgtaaaagacactgagatacagaaagtatcgacacaaaagacctccaaaagt
acatcccagaagaaggcagctgtccaagaggaaatttccaaaaaagccctaatttctgaa
gaaatcaagatgtcagaggtgaaatctccagagaagctggccctcgaggaggaagcttca
acagttctgatttccgaaaaagtcaagaaatcagaagcgacctccctggaaaaatccatt
gtccatgaggaaatcactaaaacatcacaggcatcagaagaaatcagaactcatgctgag
attaaagcatattctactcagatgagtatacctgatggtcagaaagtgactttaaaagcc
aacattgctggtgccactgatgtgaaatgggtattgaatggggtagagctcagtaactcc
gaggagtacagatatggcgtctcaggcagtgaccagacactgaccatcaagcaggctggt
cacaaagatgaagggatcctcacctgcattggcaaaaccagccaaggaatcatcaagtgt
cagtatgatctgaccctgagcaaagaactctcagatgctccagccttcatctcccagccc
agatctcaaaatgttaacgaaggacaaaatgttctcttttcttgtgaaatcagtggtgag
ccatcgcctgaaatcgaatggtttaaaaacaacctgccgatttctgtttcttcaaatatc
agcgtaagtcgctccagaaatgtatattcccttgaaatccgaaaggcctcagtaagtgac
agtgggaaatacacaattaaggccaaaaatttccatggccagtgttcagctactgcttcc
ttaacggtccttcctctagttgaagaacctcccaaagaggtagtattgaggacaagtggt
gacacgagcttgcaaggaagcttctcatctcagtcagtccaaatgtctgcctctaagcag
gaggcctccttcagcagtttcagcagcagcagtgctagcagcatgaccgaaatgaaattt
gcaagcatgtctgcccaaagcatgtcctccatgcaagagtcttttgtagaaatgagttcc
agcagttttatgggaaaatctagtatgacacaactggaaagctcaactagtaggatgctt
aaagcaggcctaagaggaattccacctaaaattgaagctcttccctctgacatcagcatt
gacgagggcaaagttttaacagtagcctgcgcttttacgggtgagcctaccccggaaata
acatggtcccatggtggaagaaaaattcaaaatcaagaacagcaagggagattccatact
gaaaacacagatgacctgacaactctgatcatcatggatgtacagaaacaagatggtgga
ctttataccctgagcttagagaatgaatttggatctgactctgctactgtgaatataaat
attcgatccatttaa

DBGET integrated database retrieval system