KEGG   Delphinapterus leucas (beluga whale): 111173857Help
Entry
111173857         CDS       T05885                                 

Gene name
HSD17B6
Definition
(RefSeq) 17-beta-hydroxysteroid dehydrogenase type 6
  KO
K13369  17beta-estradiol 17-dehydrogenase / all-trans-retinol dehydrogenase (NAD+) / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.105 1.1.1.239]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00140  Steroid hormone biosynthesis
dle00830  Retinol metabolism
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    111173857 (HSD17B6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    111173857 (HSD17B6)
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     111173857 (HSD17B6)
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     111173857 (HSD17B6)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     111173857 (HSD17B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Motif
Other DBs
NCBI-GeneID: 111173857
NCBI-ProteinID: XP_022427505
UniProt: A0A2Y9N010
Position
Unknown
AA seq 317 aa AA seqDB search
MWLYLAVLVGLYYLLRWYQERQVVSHLQDKFVFITGCDSGFGNLLARQLHLRGLRVLAAC
LTEQGAEQLRNQTSDRLETVILDVTKTESITAATEWVKERVGNRGLWGLVNNAGIFHPHG
YTEWLKIEAYMDTLKVNLIGLIEVTLSMLPLVRRAQGRIVNVSSILGRIAFFGGVYSSTK
YGVEAFSDILRRELQHFGVKISIIEPGYFRTGMSDLQKSSEAAKQVWKEVPVHIKESYGQ
KFFDTYHDLLKQGMLSCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTS
LADYILTRSWPKPAQAV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgtacctggcggtccttgtgggcctgtactacctcctgcgctggtaccaggag
aggcaggtggtgagccacctccaggacaagttcgtcttcatcacgggctgtgactcgggc
ttcgggaacctgctggccaggcagctgcacctgcgaggcttgagggttctggctgcgtgt
ctgacggagcagggggccgagcagctgaggaaccagacatcagacaggttggagacggtg
atcctggacgtcaccaagactgagagcatcactgcggccactgagtgggtgaaggagcgt
gtggggaacagagggctctggggtctggtcaacaacgcaggcatttttcacccgcatggc
tacactgagtggttgaagattgaggcctatatggataccctcaaagtgaacctcattggt
ttgatagaggtgaccttaagcatgcttcccttggtaaggagagcacaggggaggattgtc
aatgtctccagcattcttgggagaattgctttctttggaggagtctactcttccaccaag
tatggagtggaagccttttcagatattctgaggcgtgagcttcaacattttggggtgaaa
atcagcataattgaacctggctacttcagaacaggaatgtcagatttgcagaagtcctca
gaggcagcgaaacaagtctggaaagaagtccctgtgcatattaaggagtcctatggacag
aagttttttgatacctatcacgatctcctgaaacaagggatgttgagttgtagcacaaac
ctgaacctggttactgactgtatggaacatgccctgacatctgttcatccccgcactcga
tactcagctggctgggatgctaagtttttcttcatccctctatcttatttacctacatca
ctggcagactacatattgactagatcttggcccaaaccagcccaggcagtctaa

DBGET integrated database retrieval system