KEGG   Delphinapterus leucas (beluga whale): 111174017
Entry
111174017         CDS       T05885                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111174017 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dle04040]
    111174017 (ASIC1)
Ion channels [BR:dle04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   111174017 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 111174017
NCBI-ProteinID: XP_022427909
UniProt: A0A2Y9MZK6
Position
Unknown
AA seq 640 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVGDRVAYYLSYPHVTLLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPM
LGLDESDDPGVPLAPPGPEAFSGEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSV
VFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIK
VQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFFDSYSIT
ACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCN
LTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEI
AGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSL
DDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaggaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgttgcacggcctggcccacatcttctcctacgagcggctgtct
ctgaagcgggcgctctgggccctctgcttcctgggctcactggctgtgctgctgtgtgtg
tgcaccgagcgtgtgcagtactacttccactaccaccacgtcaccaagctcgacgaggtg
gctgcctcccagctcaccttccctgctgtcacgctgtgcaacctcaacgagttccgcttt
agccaagtctccaagaatgacctgtaccacgctggggagctgctggctctgctcaacaac
aggtatgagataccagacacacagatggcagatgaaaagcagctggagatactgcaggac
aaggccaacttccgcagcttcaagcccaagcccttcaacatgcgcgagttctacgaccgt
gcggggcacgacattcgagacatgctgctctcctgccacttccggggggaggtctgcagc
gctgaggacttcaaggtggtcggggatcgagttgcctattacctcagctacccacatgtg
actctgctagatgaagtggccacgacggagctggccttcccggcggtcaccctctgcaac
accaacgccgtgcggctgtcccagctcagctaccccgacttgctctacctggcccccatg
ctggggctggatgaaagcgatgaccccggggtgcccctcgccccaccggggcccgaggcc
ttctctggggagccctttaatctgcaccgcttctacaatcgctcctgccaccggctggag
gacatgctgctctattgctcctactgcggggggccctgtggccctcacaacttctcagtg
gtcttcacacggtacggaaagtgctacacgttcaactctggccgagatgggcgtcccagg
ctgaagaccatgaagggtgggacgggcaatgggctggagatcatgctggacattcagcag
gacgagtacctgcctgtgtggggggagaccgatgagacatccttcgaagcgggcatcaaa
gtgcagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtagcc
ccagggttccagaccttcgtggcctgtcaagagcagcggctcatctacctgcccccgccc
tggggcacctgcaaagctgttaccatggacttggatttcttcgactcctacagcattacc
gcctgccgcatcgactgtgagacccgctacctggtggagaactgtaactgccgcatggtg
cacatgccaggggatgccccatactgcactccagagcagtacaaggagtgtgcagatcct
gccctggacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccctgcaac
ttgactcgctatggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaag
tacctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctg
gacattttctttgaagtcctcaactatgagaccattgagcagaagaaggcctatgagatc
gcaggactcctgggtgacattggaggccagatgggtctgttcatcggggccagcatcctc
actgtgctggagctcttcgactacgcctacgaggtgataaaacacaagctgtgcagacga
gggaagtgccagaaggaggcaaaacggagcagcgcggacaagggcgtggccctcagcctg
gatgacgtcaaaagacacaacccgtgtgagagcctccggggccatcctgccgggatgacg
tatgctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgc
tga

DBGET integrated database retrieval system