KEGG   Delphinapterus leucas (beluga whale): 111174247
Entry
111174247         CDS       T05885                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle05200  Pathways in cancer
dle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111174247 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111174247 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    111174247 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111174247 (MECOM)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    111174247 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 Zn-ribbon_8 zf-C2H2_11 zf-met PyrI_C
Other DBs
NCBI-GeneID: 111174247
NCBI-ProteinID: XP_022428470
UniProt: A0A2Y9N2P1
Position
Unknown
AA seq 1239 aa
MRSKGRARKLATSNECVYGSYPEIPLEEMPDADGVASTLSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHDTMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLREIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPPVGDDKPVEFQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLPNLASIHNKKEHSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSAGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSVPAKPPVTPATSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGEKKGGNGEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGNSNHSSQSPRNTEERMNGSHFKDEKALVTSQNSDLLDDEE
VEDEVLLDEEDEDNDITGKTGKEPGTSTLHEGNHEDDYEDTSTLEMSCKASPMRYKEEEY
KTGLSALDHIRHFTDSLKMRKMEDNQYTEAEVSSFSASHVPEELKQPLHRKSKSQAYAMM
LSLSDKESLHSSSHNSSNVWHSMARAAAESSAIQSISHV
NT seq 3720 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgtgtatggcagc
taccctgaaattcctttggaagaaatgccagatgcagatggagtagccagcactctctcc
ctcaatattcaagagccatgctctccagctacatccagcgaagcattcactccgaaggag
ggctctccttacaaagcccccatctacatccctgatgatatccccattcctgctgagttt
gaacttcgagagtcaaatatgcctggagcaggccttggaatatggaccaaaaggaaaatt
gaagcaggtgaaaagtttgggccttatgtaggagaacagaggtcaaacctgaaagacccc
agttatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcagcac
aacctcgttgcatgccagataaatgatcagatattttatagagtagttgcagacattgca
ccaggagaggagctcctgctgttcatgaagagtgaagactatccccatgacactatggca
ccggatatccacgaagaacggcaataccgctgtgaggactgtgaccagctctttgagtcc
aaggctgaactagcggatcaccagaagttcccatgcagcacaccccactcggcattctcc
atggtagaggaggactttcaacaaaaactcgagagtgaaaatgatctccgagagatacat
gcaattcaggagtgtaaggaatgtgaccaagtgtttcccgatttgcaaagcctggagaaa
cacatgttgtcacatactgaagagagggaatacaagtgtgatcagtgtcctaaggcattt
aactggaagtccaatttaatccgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgagaactgtgccaaggttttcacggaccctagcaaccttcagcggcacatccgctct
cagcatgttggtgcccgggcccacgcgtgcccggagtgtggcaaaacgtttgccacttcg
tcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgaggtc
tgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgctgat
tgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcctta
aataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggc
caaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgagt
catgccaacccgggccttgctgactattttggcgccaataggcatcccgctggtcttacc
tttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttgtac
cacaggcctcctttgatacctgctagttctcctgttaaaggactgtcaagtactgaacag
acaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacaggat
attttgaaggcactatctaaacacccacctgtaggggacgataagccagtggagttccag
cccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacaccaagtggcagtgacctggaaaccacctcgggctctgac
ctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacaaagtaagccctcttccgaatctggcttcaatacataataagaaagaacacagcaat
cattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaatgat
tctataaaggctatcgcttctattgctgagaaatactttggttcagcaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccgtttttt
ccagcattctctcaatcaatgtacccatttcctgatagagacttgagatcgttacctttg
aaaatggaaccccagtcaccaagtgaagtaaagaaactgcagaagggcagctccgagtct
ccctttgatctcaccactaaacgcaaggacgagaagcccttgacctcagtacccgccaag
cctccagtgacgccggccacaagccaagaccaacccctggatctaagtatgggcagtagg
agtagagccagtgggaccaagctgacagagcctcgtaaaaaccacgtgtttggggaaaag
aaaggaggcaacggtgaaccaagaccagcatctgatggttccttacagcacgctagaccc
actcctttcttcatggaccctatttacagagtagagaaaagaaaactaactgacccactt
gaagctttaaaagagaaatacttgagaccttctccaggattcttatttcacccgcaattc
caactgcctgatcagagaacttggatgtcagctattgaaaacatggcggagaagctggag
agcttcagtgccctgaaacctgaggccagtgaacttctacagtcggttccctccatgttc
aacttcagagctcctcccaacgccctgccagagaacctcctgcggaaaggaaaggaacgc
tatacctgcagatactgtggcaagatttttccaagatctgcgaacctgacacggcacttg
agaacccacacaggagagcagccttacagatgcaagtactgtgacaggtcattcagcata
tcttctaacctgcagcggcatgttcgcaacatccacaataaagagaagccctttaagtgt
cacttatgtgataggtgttttggtcaacaaaccaacttagacagacacctaaagaagcac
gagaatgggaacatgtctggtacggccacatcgtcgcctcattctgaactggaaagtaca
ggtgcgattctcgatgacaaggaagatgcttacttcacagaaattcgaaatttcatcggg
aatagcaaccatagcagccagtctcccaggaacacagaagagagaatgaatggcagtcac
tttaaagatgaaaaggctttggtgaccagtcaaaattcagacttactggatgatgaagag
gtggaagacgaggtgttgttagatgaggaggatgaagacaatgatattactgggaaaaca
ggaaaggaaccagggacaagtactttacatgaaggaaaccatgaggatgactatgaagac
accagcaccctggagatgagttgcaaggcgtccccaatgaggtataaagaggaagaatat
aaaactggactttctgctctagatcatataaggcacttcacagatagcctcaaaatgagg
aaaatggaagataatcaatatactgaagctgaggtgtcttctttcagtgcttcccatgtg
ccagaggaacttaaacagccgttacacagaaagtccaaatcacaggcatatgctatgatg
ttgtcattgtccgacaaggagtccctccattcttcatcccacaattcttccaacgtgtgg
cacagtatggccagggctgcggcggaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system