KEGG   Delphinapterus leucas (beluga whale): 111176010Help
Entry
111176010         CDS       T05885                                 

Gene name
ADSSL1
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylosuccinate synthetase isozyme 1
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00230  Purine metabolism
dle00250  Alanine, aspartate and glutamate metabolism
dle01100  Metabolic pathways
Module
dle_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111176010 (ADSSL1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111176010 (ADSSL1)
Enzymes [BR:dle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     111176010 (ADSSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt hSac2
Motif
Other DBs
NCBI-GeneID: 111176010
NCBI-ProteinID: XP_022431648
UniProt: A0A2Y9NQM8
Position
Unknown
AA seq 457 aa AA seqDB search
MSGTRASNDRPPAAGGVKRGRLQHEAATTGSRVTVVLGAQWGDEGKGKVVDLLAADADIV
SRFQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAMSFIGNGVVVHLPGLFEEAEKNEKKG
LKDWEKRLILSDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTRKGIGPAYSSKAARTGL
RVCDLLSDFDEFSTRFKNLAHQHQSMFPTLEIDVEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGAPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGEVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQSRGHEWGVTTGRKRRCGWLDLMTLRYAHMVNGFTALA
LTKLDILDVLDEIKVGIAYRLSGKRIPYFPANQEILQKVEVEYETLPGWKADTTGARKWE
DLPPQAQSYIRFVENHVGVAVKWVGVGKSRDSMIQLF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggacccgagcctccaacgaccggccccccgccgcaggcggcgtcaagcggggg
cggctgcagcacgaggcggcgaccaccggctcccgggtgaccgtggtgctgggcgcgcag
tggggggacgagggcaaaggcaaggtggtggatctgctggccgcggacgccgacatcgtc
agccgcttccaggggggcaacaatgctggccacaccgtggtggtggacggcaaggagtat
gacttccatctgctacccagcggcatcatcaacaccaaggccatgtccttcattggcaac
ggagtggttgtccacttaccaggcttgttcgaagaagcagaaaagaatgagaagaaaggc
ctgaaggactgggagaagaggctcatcctctctgaccgggcccacctcgtgttcgatttt
caccaggcggtggatgggctccaggaggtgcagaggcaggcccaggagggcaagaacatc
ggcaccaccaggaaggggattggaccggcctactcatccaaggcggcccgcacgggcctc
cgtgtctgtgacctcctgtcagacttcgacgaattctccacccggttcaagaatctggcc
catcagcaccagtccatgttccccactttggaaatagacgttgaaggtcaactcaaaagg
ctgaagggcttcgctgagcggatccgacccatggtccgagacggcgtttacttcatgtac
gaggcgctccacggcgcccccaagaagatcctcgtggaaggcgccaacgcagccctcctc
gacattgacttcgggacctacccctttgtgacgtcatccaactgcacggtgggcggcgta
tgcaccggcctgggcatccccccccagaacataggcgaggtctacggcgtggtgaaggcc
tacaccacacgcgtgggcatcggcgccttccccaccgagcagatcaacgagatcggtgac
ctgctgcagagccgcggccacgagtggggcgtgaccacaggcaggaagaggcgctgtggc
tggctggacctgatgaccctcagatacgcccacatggtcaacggattcaccgcgctggcc
ttaacgaagctggacatcctggacgtcctggacgagattaaagtcggcatcgcgtacagg
ctcagcgggaagcggatcccctacttcccagccaaccaggagattctgcagaaggtggag
gtggagtatgagacgctgcctgggtggaaggcggacactacgggcgccaggaagtgggag
gacctgcccccacaggcccagagctatatccggtttgtggagaaccacgttggagtggca
gtgaaatgggttggtgttggcaaatccagagattcgatgatccagctgttttag

DBGET integrated database retrieval system