KEGG   Delphinapterus leucas (beluga whale): 111176604Help
Entry
111176604         CDS       T05885                                 

Gene name
WNK1
Definition
(RefSeq) serine/threonine-protein kinase WNK1 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111176604 (WNK1)
   01009 Protein phosphatases and associated proteins [BR:dle01009]
    111176604 (WNK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111176604 (WNK1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  Wnk family
   111176604 (WNK1)
Protein phosphatases and associated proteins [BR:dle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111176604 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 111176604
NCBI-ProteinID: XP_022432908
UniProt: A0A2Y9NTX5
Position
Unknown
AA seq 2825 aa AA seqDB search
MSGGAADQQSSAPGSLFLSPPAPPPKNGSSSDSSVGEKLGAASADAGAGRTEEYRRRRHT
MDKDSRGAVATTTTEHRFFRRSVICDSNATALELPGLPLPLPQTSAAAVVPQRSPPEPQR
EETLTPTAAHVAQQPPAAAAAAAAPAPGEPVAAGPAAASAPGSAGRDRQVAQPGHAGSKE
EPPSSRSGSGGGSAKEPQEERSQQQDDIEELETKAVGISNDGRFLKFDIEIGRGSFKTVY
KGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKC
IVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIF
ITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMA
TSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNH
AFFQEETGVRVELAEEDDGEKIAIKLWLRIEDTKKLKGKYKDNEAIEFSFDLERDVPEEV
AQEMVDSGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKRKQEESSLKQQGEQQ
SSASQAGAQQPPSTCTGGPAASTTSASVSTQVEPEEPEADQHQQLQHQPPGVSVLSDGTI
DSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTLPGHTASVVQAQAQPHGVYPPSSMPQ
SMAHPCGGTPTYPESQIFFPTIHERPVSFSPPPTCPPKVAISQRRKSTSFLEAQTHHFQP
LLRTVGQNLLPPGGSPTNWTPEAVVMLGTAASRVTGEPCETQVQPMFEPTQVYSDYRPGL
VLPEEAHYFIPQEAVYLAGVQYQAQVAEQFEGIPYNSPVLSSPMRQTPEQKPGQGGPTSS
SVFEFPPGQAFVVGHLQNLRLDSGLSPGSPLSSISAPISTDATGLKFHPVFVPHSAPAVL
THNNESRSNCVFEFHARTPCSSSGEGGGGVLPQRIYRNRQVAVDLNQEEPPPQSTGLHGR
LQPVTEEQHDFQAPELTVSVVEPTGQSWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAA
ASFGSDVSLPFIRLPQTVLQESPLFFCFPQGATSPQVLSASFSSGGSALHPQAQGQSQGQ
QSSSSLTGVSSSQPIQHSQQQQGVQQTTPSQQTAQYSLPQMSASSEAMTAQPTSQPQPPQ
SFSHVSTGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPPSSLPQYSV
SQIPSAPQPAFSPLPVTMAAGVNQPLLTLASSAPAAAVPGGPAVVPSQLPTLLQPVTQLP
SQAHPQLLQPAVQSTGIAANLGQTAEAPLPSGDVLYQGFPPRLPPQYPGDSNLAPSSSVA
SVCIPSTVLSPPMPAEALAAPGYFPTVVQPYVESSLLVPVGSIGGQVQVSQPAVSLAQAP
STSSQQAALESTQGVSQVAPPEPVPVAQPQPTQPATLVSSVDSAHSDVASGMSDGNENVP
SSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETHNRKMVTF
KFDLDGDNPEEIATIMVNNDFILAMEREAFVEQVRDIIEKADEMLSEDVSVEPEGDQGLE
SLQGKDDYGFAGSQKLEEFKQPIPASSMPQQIAGLPTSSLTQVVHSAGRRFIVSPVPESR
LRESKIFSEVSDTVAASTSAGAGMSLSHSASSLGLQQAFSELRHAQMAEGPSTAPANFRP
TGPAFPAVPPSVISPAGAPATAAAVPSASAPATGCPLSDASASAVQSEVAVPTEKGIAGV
ATCTGVTPSSGLPVPLASESPILSSVVSSITVPAVISVSATSQSVQAPTPGSVVSGTGTF
PSVPVSVTAASAVSSAAAPGAKPSPVSSQQVAGSMAGTATLTSVSAAAPVPSLAAQPSLP
PSSSTSALTRAETVVVSAHALDKISHSSVTGLALSLPASSSSPSLGAGVSSAVSQPGVAH
PLVIPSAVASTPALSQAGPTSTPLLPQASIPPLVQPVANVPAVQQTLIHSQPQPALLPNQ
PHTHCPEIDADTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLDTSLVMETTVTP
GLPTTAVAPSKLMTSTTSTCLPPTSLPLGTTGSSVIPAVTPGQVSTPVSAVPGVKPGTAA
PKPPLTKPPVLPVGTELPAGTPPSEQLPPFPGPSLTQPQQPLGDLDAQLRRTLSPETVVL
TSAVGPVSVVAPTAVVEAGAQLQKDVSQVTEGPILAPTSGTGVFKMGRFQVSVAMDDPQK
EGKNKSEDVKSVHFESSTSESSVLSSSSPESTLVRPEPNGIAVRGVSSDMPDSSARKTPE
TGQPTKVGRFQVTTTASKVGRFSVSRTEDEITEAKKEGPVVSPPFLDLGHDVLPAVIPKK
EKPELSEASHLNGPSSDLEAAFLGRDVDDGSGSPHSPQLSSKSLPVQGLSHSFNSSYMSS
DNESDIEDEDLKLELRRLREKHLREIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLA
GRRRRPTKSKGNKSSRSSSLGNKSPGPGNLSGQSAASVLHPQQTLPAPGNIPETGQNQLL
QPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGCAKFNCASEQVTFKPGGRRTRFLSTPC
LALWKMVKKVCPCNQLCRTSSTNTVGGTVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNW
ARDAMNLSGRRGSKGHMSYEGPGMARKFSAPGQLCVSMTSTLGGSAPISAASATSLGHFP
KPMCPPQQYGFPTPPFGTQWSGTGGPATQPLSQFQPVGTASLQNFNISNLQKSISNPPGS
NLRTT
NT seq 8478 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggcgccgccgaccagcagagtagcgcgccgggctccctgttcctctcgccg
ccggcgcctcctcccaagaatggctccagttcggactcttcggtgggagagaaactgggc
gccgcgtcggctgacgccggagccggcaggacggaggagtaccggcgtcgccgccacacc
atggacaaggacagccggggggcggtcgcgaccaccaccaccgagcaccgctttttccgc
cgcagcgttatctgcgactccaacgccacggcgctggagctgcccggcctcccgctcccg
ctgccccagacgagcgcggccgcggtggtcccgcaacggagccccccggagccccagcgc
gaggagaccctgacccccactgccgcccatgtggcccagcagccgcccgccgccgccgcc
gccgccgccgcccccgcccccggggagccggtcgccgcgggcccagccgccgcctcggcc
ccgggcagcgccggcagagaccgccaggttgcccagcccggccacgcggggagcaaagag
gagcccccgtcgtcgagaagtggcagcggcggcggcagcgccaaggaaccccaggaggaa
cggagccagcagcaggatgacatcgaagagctggagaccaaggccgtgggaatatccaat
gatggccgctttctcaagtttgacatcgagatcggcaggggctcctttaagacggtctac
aaaggtctggacaccgaaaccaccgtggaggtcgcctggtgtgaactgcaggatcgaaag
ttaacaaagtctgagaggcagagatttaaagaagaggctgaaatgttaaagggtcttcag
catcccaatattgtccgattctatgattcctgggaatccacagtaaagggaaagaagtgc
atcgttttggtgactgaacttatgacatctggaacacttaaaacgtacctgaaaaggttt
aaggtgatgaagatcaaagttctgagaagctggtgccgtcagattcttaaaggacttcag
tttcttcatactcgaactccacctattattcaccgggatcttaagtgtgacaacatcttt
atcactggccctacaggctcagtcaagattggagacctaggtctggcaaccctgaagcgg
gcttcttttgccaagagtgtgataggtaccccagagttcatggcccctgagatgtatgag
gagaaatatgatgaatccgttgacgtttatgcttttgggatgtgcatgcttgagatggcc
acatctgaatacccttactccgagtgccaaaatgctgcacagatctaccgtcgagtgacc
agtggggtgaagccagccagttttgacaaagtagcaattcctgaagtgaaggaaattatt
gaaggatgcatacggcaaaacaaagatgaaagatactctatcaaagacctcttgaaccac
gccttcttccaggaggaaacaggggtacgggtagaattagcagaagaagatgatggcgaa
aagatagccattaaattatggctacgcattgaagatactaagaaattaaaggggaaatac
aaagacaatgaagctattgagttttcctttgacttggagagagatgtaccagaagaggtt
gctcaagaaatggtagactctgggtatgtctgtgaaggtgatcacaagaccatggcaaaa
gccatcaaagatagagtgtcattaattaagaggaagcgagaacagcgtcagttggtgcgg
gaggagcaagaaaaaagaaagcaggaagagagcagcctcaaacagcagggggagcagcag
tccagtgcttcccaggcaggagcccagcagcccccttcgacgtgcactggtggacctgcg
gcctctaccacttcagcttctgtttccacacaagtagagccggaggagcctgaggcagat
cagcaccaacagctgcagcaccagccacctggtgtgtctgtgttgtctgacgggacgatt
gacagtggtcagggatcttctgtcttcacagagtctcgagtgagcagccaacagacagtt
tcgtatggttcccagcatgagcaggcacattccactggcaccctcccagggcacacagcg
tctgttgtccaagcacaggctcagccccatggggtatatccaccctcaagtatgcctcag
tccatggcgcatccgtgtggggggaccccaacatacccagaatcacagatatttttccca
actattcatgaacgtccagtttctttttcaccacctcccacctgtccaccgaaggtggcc
atttcccagcggcgtaagagcacctccttcctggaagcccaaactcaccacttccaaccc
ctgctgaggactgttggccaaaatcttcttccacctggtggcagcccaactaactggaca
ccagaggctgtagttatgttgggtactgcagccagtagagtcactggagagccatgtgag
acacaggtccaacctatgtttgaaccaactcaagtttacagtgactatagacctggacta
gtacttccggaagaagctcactactttattcctcaggaagcagtgtatctagctggggta
caataccaggcccaggtggcagaacagtttgagggcattccatacaactcaccagtcctg
tcaagtcctatgagacagacacctgaacagaagccagggcaagggggccctacctcaagt
tctgtctttgaatttccacccggacaggctttcgtggtaggacacctccagaatttaaga
ttagattctggactgagcccaggatctcccctctctagcatttctgcacctatcagtaca
gacgctacaggcttgaaatttcaccctgtctttgttcctcattctgcacctgctgtgtta
actcataacaatgagagcagaagcaattgtgtatttgagtttcacgctcgtactccatgc
tcctcttcaggagaaggaggaggaggagttttgcctcagcgcatttaccgaaatcgacag
gttgctgtggacttgaatcaggaagaaccacctcctcaatccacaggattacacggccgc
ctgcagcctgtgactgaagaacagcatgatttccaggccccagaactgaccgtctctgtg
gtagagcccaccggacagagctggcccataggaagcccagaatattccagtgattcctca
caaatcacttcttcagaccccagtgattttcaatcacctccccctacagggggagcagct
gcatcttttggctctgacgtctcattaccctttatccgtctgcctcagacagtgttacaa
gaatccccacttttcttctgtttcccccaaggagccacatctccgcaggttttatctgcc
tcattttcttcgggaggatctgcactccatccacaggcacaggggcagagccagggtcag
caatcttcaagtagtttaacaggggtttcatcctcccaacccatacaacattctcagcag
cagcaaggagtgcagcagacaaccccctctcagcagacagcgcagtattcacttccccag
atgtcagcctccagcgaggccatgactgcacagcccacaagtcagcctcaacctccacag
tccttttcgcatgtgtcaacaggaaaacagcttccagtttcccagccagtaccaactatc
caaggcgaacctcagatcccagttgcgacacagccctcagttgttccagtccattctggt
gctcacttcctccctgtgggacagccactcccgccttcctcactcccccagtactctgtc
tctcagatcccctcagctcctcagccagctttctccccgcttcctgtcaccatggcagct
ggcgttaatcagcctctgcttaccttggcttcctctgctccagcagctgcagtccctggg
ggacccgccgtggtccctagtcagcttcccaccctcctgcagcctgtgactcagctgcca
agtcaggctcacccgcagctcctgcagccagcagttcagtccacggggatagccgctaac
ctcgggcagactgctgaggctccactcccctctggagatgttctctaccagggcttccca
cctcgactgccaccacagtacccaggagactcaaatcttgctccctcttccagcgtggct
tctgtgtgcattccttctacagtcctgtcccctcccatgccggcagaagcactggctgca
ccaggttactttcctacagtggtgcagccttatgtggaatcaagccttttggttcctgtg
ggcagtataggaggacaggttcaagtgtcccagccagcagtgagtttagcacaagccccc
agtacatcctcccagcaagcagctctggagagcactcagggcgtctctcaggtggctcct
ccagagccagttccagtggctcagccacaacctacccagcctgctacattggtctcttct
gtagacagtgcacattcagatgttgcttcaggtatgagtgacggcaatgagaatgtccca
tcatccagtggaaggcatgaagggagaactacaaaacggcattatcgaaaatctgtaaga
agtcgctctcgtcatgaaaagacttcacgcccaaaattgagaattttgaatgtttcaaat
aaaggagaccgggtagtagaatgtcaattagagactcacaatcggaaaatggttacattc
aaatttgatttagatggtgacaaccctgaggagatagcaacaattatggtgaacaatgac
tttattctggcaatggagagagaggcatttgtggaacaagtgcgggatattattgaaaaa
gctgatgaaatgctcagtgaggacgtcagtgtggagccagagggtgaccagggattggag
agtctccagggaaaggatgactatggctttgcaggctctcaaaaattggaagagttcaaa
caaccaattcctgcatcttccatgccacagcaaatagcaggccttcctaccagttcttta
actcaagttgttcattctgccggaagacggtttatagtaagtcctgtgccagaaagtcga
ttacgagaatcaaaaattttcagtgaagtatcagatacagttgctgcttctacatctgct
ggtgctggaatgagcttgtctcactctgcttcatcccttggtctacagcaggccttttct
gaacttagacatgcacaaatggcagaagggccgagcacagcacctgccaacttccgtccg
acggggccagcgttcccagcagtgcccccttccgtgatcagccctgctggagctccagcc
acagcggcagccgtaccctcagcgtcagcccctgccacgggctgccctcttagtgacgct
tccgcatcagctgttcagtctgaggttgcagtgcccactgaaaaggggattgctggagtt
gccacctgcacaggtgtaacaccctccagtggtctccctgtaccacttgcatctgaatcc
ccgatactttccagtgtggtgtcaagcatcacagtgcctgcagtcatctcagtatcagcg
acatcccagtcagttcaggctcccacacctgggagcgttgtttccggtacaggcacgttc
ccctctgtaccagtctcagtgacggcagcctctgcagtgagcagtgctgctgccccaggc
gctaagccttcacctgtatcgtcgcagcaggtggcgggcagcatggctgggacagccacg
ctaacatccgtgtcggcagccgctccagtcccgagtctagctgcacagccgtcccttcca
cccagcagcagcacctctgctcttactcgagctgagactgtagtggttagtgcacacgca
ctggataagatatctcatagcagcgtgaccggattggctttgtccctccccgcgtcatct
tcctctccctccctgggggcaggggtatctagtgctgtttctcagcctggcgtggctcat
cctttggtcatcccatcagctgtggcttctactcctgccctttcccaggcaggacctact
tccacacctttactaccccaagctagtatcccacctttggtacaacctgttgccaatgtg
cctgctgtacagcagacactaattcatagtcaacctcaaccagctttgcttcccaaccag
ccccatactcactgtcctgaaatagatgctgatactcaacccaaagctcctgggattgat
gacataaagactttagaggaaaaactgcggtctctctttagtgagcacagctcatctgga
gctcagcatgcttctgtctcgctggacacgtcactcgtcatggagaccactgtcacacca
ggcctcccaaccactgctgttgcaccaagcaaactcatgacttccactacaagtacttgc
ttaccaccaaccagtttgcccttaggaacaactggttcgtcagttataccagcggtcact
cctgggcaagtttccaccccagtcagcgctgtaccaggagtgaaacctggaactgctgca
ccaaagccacctttaactaagcctccagtgttgccagtgggtactgaacttccagctggt
actccacccagcgagcagctgccaccttttccaggaccttcactaacgcagccccagcag
cccctgggagatctggatgctcagctgagaagaacgctcagtccagagaccgttgtgctg
acgtctgcagttggtcccgtgtccgtggtggctccaacagcagttgtggaagcaggagcc
cagcttcagaaggatgtgtctcaagtcacagaaggtcctatcctagcacccacttcaggg
actggtgtttttaagatggggcgatttcaggtttcagttgcaatggatgatccccagaaa
gagggtaaaaataagtcagaagatgtaaagtctgttcattttgaatccagtacttcagag
tcctcagtgctgtcaagcagtagtccagagagtaccctggtgaggccagagcccaatggg
atagccgtccgtggcgtctcttcagatatgccggatagtagcgcccgtaaaactcctgaa
actgggcagccaaccaaggttggacgttttcaggtgacaactacagcaagcaaagtcggt
cgtttctccgtttcaagaaccgaagacgagattactgaggcaaagaaggagggaccagtg
gtatctcctccttttctggatttgggacatgacgttcttcctgctgtgataccaaagaaa
gagaaacccgaactgtcagaggcttcacatctgaacgggccgtcctctgacctggaggct
gccttcctcggtcgggatgtggacgatggctcagggagtccgcactccccgcagctgagc
tcaaagagcctccctgtccagggcctgagtcattccttcaactcctcttacatgagcagc
gataatgaatcagatattgaagatgaggacttgaagttagagctgcggcggctacgagaa
aaacatcttagagagattcaagacctgcagagtcgccagaagcatgaaattgaatctttg
tataccaaactgggcaaggttcctcctgccgtcatcattcccccagctgccccccttgca
gggagaagaaggcgacccaccaaaagcaaaggcaacaagtctagtcgcagcagttccttg
gggaataaaagccctggaccaggtaacctgtctggccagagtgcagcttcagtcttgcac
ccgcagcagaccctccccgctcctggcaacatcccagagacggggcagaatcagctgtta
cagccccttaagccatctccctccagtgacaacctgtattcagccttcaccagtgatggt
gccatttcagtaccaagcctttctgctccaggtcaaggctgtgcgaagtttaactgtgcg
tctgagcaggtgacgttcaaacctggtggcaggaggacccgatttctgagtacgccctgc
ttggctctttggaagatggtgaaaaaagtctgtccttgcaaccagctctgtaggaccagc
agcacaaacaccgttgggggaacagtgaacagccaggccgcccaggctcagcctcctgcc
atgacgtccagcaggaagggcacgttcacagatgacctgcacaagttggtggacaactgg
gcccgagacgccatgaatctctcaggcaggagaggaagcaaaggacacatgagttacgag
ggccctggcatggcgaggaagttctccgcacctggtcagctgtgcgtctccatgacctca
accctgggtggctccgcccccatctctgcagcatcagctacctctctaggccacttcccc
aagcccatgtgccccccgcagcagtacggtttcccaacccccccctttggcacgcagtgg
agcggcacgggcggcccagcaacgcagccacttagccagttccaacctgtgggaactgcc
tccttacagaacttcaacatcagcaacttgcagaagtccatcagcaaccctccaggttcc
aacctgaggaccacttag

DBGET integrated database retrieval system