KEGG   Delphinapterus leucas (beluga whale): 111177028
Entry
111177028         CDS       T05885                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111177028 (ADAMTS13)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     111177028 (ADAMTS13)
Peptidases and inhibitors [BR:dle01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   111177028 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_spondin TSP1_CCN ADAM_spacer1
Other DBs
NCBI-GeneID: 111177028
NCBI-ProteinID: XP_022433890
UniProt: A0A2Y9NIL1
Position
Unknown
AA seq 1250 aa
MASDGAAPARGGPAWSPCSRRQLLSLLRTGALPVGPAGAAVPARGAPPRGAPRPVLWRRR
AVPRRLRPDGGRLHLPPGDMCQALSCHTDPLDQSSCSRLLIPVLDGTECGVGKWCSKGHC
RSLAELAPVGAVHGHWSSWGPASPCSRSCGGGVVTRRRQCNNPRPAFGGHACVGADLQAK
MCNSQACEKTQLEFMSEQCAQTNGEPLRLSPGSTSFYRWGTAEQHSRGDALCRYLCRAIG
ESFIVRRGDSFLDGTRCVPSSPQEDGTLSLCVSGSCKTFGCDGRMASGQVRDVCQVCGGD
NSTCRPQNGSFTAGRAREYVTFLAVAPNLTHIYIINHRPLFTHLAVKIRGRYVVAGNASI
SPSTTYPSLLEDSHIQYKVTLTEDRLPRLEEIRIQGPTQDDMEIQVYRRYGEEYSSLARP
DITFTYFQPKRRPAWVWAPVRGACSVSCGAGLRWVTHSCRDQAANEWVEAAWCAGSRQPA
AWSESCASIPCPPSWAAGDFGPCSASCGGGLQERVVRCVEAQGGLLRTVPHFRCRALAQQ
PAAVETCNPQPCPRREMPDACSSACGTDPAVQNTTCVQGADGMGAPATAGPCSADEKPPA
LEPCIEVACPPGWGHSDAQSPGEKAASPAGSARPEAYAAHVWTPLAGPCSVSCGQGLMEL
RFVCMDSALRTPVREELCDLAGKPGSRQEVCQAAPCPAWWETRALAPCPVTCGGGQVPLA
VRCVRMDQGRVVSLPHSKCWPMPRPRPLEDCSPEPCPARWRYQLAACSVTCGGGVAQRIL
YCARAHGEDKAEEILPDTQCQGLPRPEQQEACSPEPCPPRWKVMSLGPCSASCGLGTAMR
LVACVQLDQGQDTEVDGAACVGLVRPQASIPCIIADCTYRWHVSAWMQCSVSCGDGIQRR
HDACLGPQAQVPVPADFCQHLPKPVTVRGCWAGPCAGQGTPSPVPHEESTAPGQTTAATA
SPQWPQPQARLLSPAPRPQGLPPGPQESPAESSACGRQHLEPTGTIDMRGPARADCAVAI
GRPLGEVVTLRVLDSSLNCSAGEMLLLWGRLTWRKMCRKLPGLTFSSKANTLVVRQHLVQ
LRGGVLLRYSSQPAPGAFHRGMARPWSLPAFPRGWLAGCCCQRGQSRRASGQGRQGAELT
ENEKQRLPGHPPTPPSLYGRSGRGPGGARCSFLSGALREMGGHPHPLPQAIAGPTPWPRH
SGPSGSFKVLLRASSPSPVGCAVLLAHPPPSRAWVHVHTSCGGWRPREPC
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggcttccgacggcgccgcgcccgcccgcgggggcccggcgtggtccccctgcagccgc
cggcagctgctgagcctgctcaggacgggcgcgctgcctgtgggacccgccggggccgca
gtcccagcccgcggggctccaccccgaggcgcaccccggcctgtactatggcgccgacga
gcagtgccgcgtcgccttcggcccgacggcggtcgcctgcaccttccgccgggagacatg
tgccaggctctctcctgccacacagaccccctggaccaaagcagctgtagccgcctcctt
attcctgtcctggatgggacagagtgtggcgtggggaagtggtgctccaaggggcactgc
cgctccctggcggagctggcccccgtgggggcggtgcatgggcactggtctagctggggt
ccggccagtccttgctcccgctcctgcggaggaggtgtggtcaccaggagacggcagtgc
aacaaccccagacctgcctttggggggcatgcgtgcgtaggtgctgacctccaggccaag
atgtgcaacagccaggcctgcgagaagacccagctggagttcatgtcggagcagtgcgcg
cagaccaacggggagcccctgcgcctctccccgggcagcacctccttctaccgctggggc
acggctgagcagcacagccgaggggacgctctgtgtagatatctgtgccgggccattggc
gagagcttcattgtgaggcgtggggacagtttcctggatggaacacggtgtgtgccaagc
agccctcaggaggatgggaccctgagcctgtgcgtgtcgggcagctgcaagacgtttggc
tgtgacggcaggatggcctctgggcaggtgcgagatgtgtgccaggtgtgtggcggggac
aacagcacgtgccgtcctcagaacggctctttcacggccggaagagccagagagtatgtc
acattcctggccgttgcccccaacctgacccacatatacatcatcaaccacaggcctctc
ttcacgcacctggcagtgaagatccgtgggcgctacgtcgtggccggaaatgcaagcatc
tctcccagcaccacctacccctccctcctggaggacagccacatccagtacaaagtgacc
ctgactgaggaccggctgccccgcctggaggagatccgcatccagggccccacccaggac
gacatggagatccaggtttacaggcgctacggtgaggagtacagcagcctcgcccgcccg
gacatcaccttcacctacttccagcccaagcgtcggccggcctgggtgtgggctcccgtg
cggggggcctgctcggtgagctgtggggcagggctgcgctgggtgacccacagctgtcgg
gaccaggcagcgaacgagtgggtggaggctgcctggtgtgcagggagccggcagccggcg
gcgtggtccgagtcgtgtgcctccataccctgtcccccgtcctgggcggccggagacttc
ggcccatgcagtgcctcctgcggagggggcctgcaggagcgggtggtgcgctgcgtggag
gcccagggaggcctcctgaggacggtgccccacttccggtgcagagcgctggctcagcag
ccagcggccgtggagacctgcaatccccagccctgcccccggagggagatgccagatgcg
tgctcgtcggcctgtggaacagatccggccgtgcagaacacgacgtgtgtgcagggggca
gatggcatgggggcgccagcaactgctgggccctgctccgcagacgagaagccgcctgcc
cttgagccctgtatcgaggtggcatgtcctccgggctggggccattcagatgcccagtct
ccaggggagaaggctgcatccccggcgggcagtgccaggccagaggcttatgccgcacac
gtgtggactcccttggcggggccgtgctccgtctcctgtggtcaaggcctgatggagctg
cgtttcgtgtgcatggactctgccctcaggacacccgtccgggaagagctgtgtgacctg
gcaggcaagcctgggagccggcaggaggtctgccaggctgccccgtgcccggcttggtgg
gagacccgagccttggcaccgtgccccgtgacctgtggaggggggcaggtgccactggct
gttcgctgtgtgaggatggaccaaggccgcgttgtctccctgcctcattccaagtgctgg
ccgatgcctcggcccaggcccctcgaggactgcagcccggagccctgccctgccaggtgg
cggtaccagctggcggcctgcagcgtgacctgtgggggaggagttgcgcagaggatcctg
tactgcgcccgggcccacggggaggacaaggccgaggagatcctgccggacacccagtgc
caggggctgcctcgcccagagcagcaggaggcctgcagcccggagccctgcccgcccagg
tggaaggtcatgtcccttggcccatgttcagccagctgtggtctcggcactgccatgcgc
ttggtggcctgtgtgcagctggaccaaggccaggacacagaggtggacggggcggcctgt
gtaggtctggtgcggccgcaggccagcatcccctgcatcatcgccgactgcacctaccgg
tggcacgtcagcgcctggatgcagtgctctgtctcgtgtggggatggcatccagcgccgg
cacgacgcctgcctcggaccccaggcccaggtgcccgtgccagccgacttctgccagcat
ttgcccaagccggtgacggtgcggggctgctgggctgggccctgtgcagggcaggggacg
cccagcccggtgccccacgaggaatccactgctcctggccagaccacagctgccactgct
tccccgcagtggccccagccccaggcccgcctcctctccccagctccccggccgcaagga
ctcccgcccgggccccaggaaagcccagcagagtccagcgcctgtggccggcagcacctt
gagccgacaggaaccattgacatgcgaggcccagcgcgggcggactgtgcagtggccatc
gggcggcccctgggtgaggtggtgaccctccgagtcctcgacagttccctcaactgcagt
gcaggggagatgctgctgctttggggcaggctcacgtggaggaagatgtgcaggaagctg
cccggcctgactttcagctccaaagccaacacgctggtggtgaggcagcatctcgtgcag
ctgcgaggcggagtgctgcttcggtattcgagccagcctgccccgggagccttccaccga
ggtatggcgaggccgtggagcctccccgccttccccagaggctggctggctgggtgctgc
tgccaacggggccagtcccgacgggccagcgggcaaggcagacagggagctgagctgact
gagaatgaaaagcagcgccttcccggacaccccccgacacccccatccctgtatgggcgg
tcaggacgaggtcccggaggtgcacggtgttccttcctctctggggccctgcgcgagatg
ggcgggcatcctcaccccctccctcaggccatcgcgggccccacaccctggccccggcac
tcaggtccttcaggatcctttaaggtccttctgcgagcctcttcccccagtcctgttggg
tgcgctgtcctcctggctcatcctccgcccagcagggcgtgggtgcacgtgcacacctcg
tgcggaggatggcgtccccgagagccctgctag

DBGET integrated database retrieval system