KEGG   Delphinapterus leucas (beluga whale): 111177477Help
Entry
111177477         CDS       T05885                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04060  Cytokine-cytokine receptor interaction
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04218  Cellular senescence
dle04350  TGF-beta signaling pathway
dle04380  Osteoclast differentiation
dle04390  Hippo signaling pathway
dle04933  AGE-RAGE signaling pathway in diabetic complications
dle05140  Leishmaniasis
dle05142  Chagas disease (American trypanosomiasis)
dle05144  Malaria
dle05145  Toxoplasmosis
dle05146  Amoebiasis
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
dle05211  Renal cell carcinoma
dle05212  Pancreatic cancer
dle05220  Chronic myeloid leukemia
dle05225  Hepatocellular carcinoma
dle05226  Gastric cancer
dle05321  Inflammatory bowel disease (IBD)
dle05323  Rheumatoid arthritis
dle05410  Hypertrophic cardiomyopathy (HCM)
dle05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111177477 (TGFB2)
   04350 TGF-beta signaling pathway
    111177477 (TGFB2)
   04390 Hippo signaling pathway
    111177477 (TGFB2)
   04068 FoxO signaling pathway
    111177477 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111177477 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111177477 (TGFB2)
   04218 Cellular senescence
    111177477 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111177477 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111177477 (TGFB2)
   05206 MicroRNAs in cancer
    111177477 (TGFB2)
   05205 Proteoglycans in cancer
    111177477 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111177477 (TGFB2)
   05212 Pancreatic cancer
    111177477 (TGFB2)
   05225 Hepatocellular carcinoma
    111177477 (TGFB2)
   05226 Gastric cancer
    111177477 (TGFB2)
   05220 Chronic myeloid leukemia
    111177477 (TGFB2)
   05211 Renal cell carcinoma
    111177477 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    111177477 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    111177477 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    111177477 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    111177477 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111177477 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111177477 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111177477 (TGFB2)
   05161 Hepatitis B
    111177477 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    111177477 (TGFB2)
   05144 Malaria
    111177477 (TGFB2)
   05145 Toxoplasmosis
    111177477 (TGFB2)
   05140 Leishmaniasis
    111177477 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    111177477 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111177477 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111177477 (TGFB2)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111177477 (TGFB2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111177477 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 111177477
NCBI-ProteinID: XP_022434950
UniProt: A0A2Y9NLP6
Position
Unknown
AA seq 442 aa AA seqDB search
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCYRQPQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttcttctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcggacagatcctgagcaagctgaaactcaccagccccccagaagactatcccgaaccc
gaagaggtccccccggaggtgatttccatctacaacagcacaagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctacagacagccccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcaggattgtccgattt
gacgtctccgccatggagaagaatgcttccaatttggtgaaggcagagttcagagtcttt
cgtttacagaacccgaaagccagagtgcctgaacaacggatcgaactgtatcagattctc
aaatccaaagatttaacatctccaacccagcgctacatcgacagcaaagtcgtgaaaacc
agagcagaaggcgaatggctctccttcgatgtcactgatgctgttcacgaatggctccac
cataaagacaggaatctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatcgaataattacatcatccccaacaaaagtgaagaactagaagcgcgatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaacaataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttaccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcctattgctttagaaat
gtgcaggataattgttgcctacgcccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgagcctaaagggtacaatgccaacttctgtgctggagcgtgcccatat
ctgtggagctcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcatctgcttccccttgctgcgtgtcccaggatttagaaccgctcaccattctctac
tacatcggcaaaacacccaagattgaacagctttctaatatgatcgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system