KEGG   Delphinapterus leucas (beluga whale): 111178030Help
Entry
111178030         CDS       T05885                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:dle00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111178030 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111178030 (CREM)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111178030 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5
Motif
Other DBs
NCBI-GeneID: 111178030
NCBI-ProteinID: XP_022436092
UniProt: A0A2Y9NYF1
Position
Unknown
AA seq 359 aa AA seqDB search
MSKCGRKKYIKTNLRQMTMEIDSQQDGSIPDSVAESESAHMQMQTGQNSIPTLAQVSVAG
SGTGRGSPAVTLVQLPSGQTVHVQGVFQTPQPSVIQSPQLQTVQVATIAETDESAESESV
IDFHKRREILSRRPSYRKILNELSSDVPGVPKIEEEKSEEEGTSPNIAAMAVPTSIYQTS
TGQYIAIAQGEAIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYATQSADGTQQFFVP
GSQVVVQDEETELAPSHMAATTGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEA
TRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCRKAE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtgtggcaggaaaaaatatattaaaacaaatctaagacaaatgaccatggaa
attgactctcagcaggatggaagtataccagattctgtggcagagagcgaatctgctcac
atgcagatgcagactggtcaaaattcaatccccactttagctcaggtttctgtagctggg
tcaggcaccggaagaggctccccagctgtaactctagtacagttaccttcaggccaaact
gtacatgtccagggagtatttcagacaccacagccatcggttattcagtcaccacaatta
cagactgttcaggtagcaacaattgcagagacagatgagtctgcagaatcagaaagtgta
attgattttcataaacgcagagaaatcctttcacgaagaccctcttacagaaaaatactg
aatgaactttcctctgatgtgcctggtgttcccaagattgaagaagaaaaatccgaggaa
gaaggaacgtcacctaatatcgctgctatggcagtgccgactagcatatatcagactagc
acggggcaatacattgctatagcccaaggtgaagcaatccagatttctaacccaggatct
gatggtgttcagggactgcaggcattaacaatgacaaattcaggagctcctccgccaggt
gctacaattgtacagtacgcaacacagtcagcagatggcacacagcagttctttgtccca
ggcagccaggtggtggttcaagatgaggaaactgaacttgccccaagtcacatggctgcc
accactggtgacatgccgacttaccagatccgagctccaactactgctttgccacaggga
gtagtgatggctgcctcgccgggaagcctgcacagtccccagcaactagcagaggaagca
acacgcaaacgagagctgaggctaatgaaaaatagggaagctgcccgggagtgtcgcagg
aagaagaaagaatatgtcaaatgtcttgaaaaccgtgtggctgtgcttgaaaaccagaac
aagactctcattgaggaactcaaggccctcaaagatctttactgccgtaaagcagagtga

DBGET integrated database retrieval system