KEGG   Delphinapterus leucas (beluga whale): 111178474Help
Entry
111178474         CDS       T05885                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dle04131]
    111178474 (DOCK7)
Membrane trafficking [BR:dle04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111178474 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 111178474
NCBI-ProteinID: XP_022436955
UniProt: A0A2Y9NSE2
Position
Unknown
AA seq 2131 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYSGSPQLLKNLNIVGSISHHTTVPLTEAVDPVDL
EDYLITHPLAVDSGLLRDLIEFPPDDIEVVYSPRDCRTLVSAVPEESEMDPHVRDCIRSY
TEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNNYQDEQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRKANRHKELFALHP
SPDEEEPIERLSVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEISTGERKGSWSERRNSSLVGRRSLERTTSGDDSCNLTSFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP
VIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLENELKSSIAALNSS
QLEPVVRFLYLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLEGNHDQHG
RNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQAMDRSCN
RMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVRESALQQAWFFFELMVKSMV
HHLYFNDKLDAPRKSRFPERFMDDIAALVSTIASDIVSRFQKDTEMVERLNTSLAFFLND
LLSVMDRGFVFSLIKTCYKQVSSKLYSLPTPSVLVSLRLDFLRIISSHEHYVTLNLPCSL
LTPPASPSPSVSSATSQSSGFSTTVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDP
DAEGLFGLHKKVINMVHNLLSSHDSDPRYSDPQIKARVAMLYLPLIGIIMETVPQLYDFT
ETHNQRGRPICIATDDYESESGSMISQTVAMAIAGTSVPQLTRPGSFLLTSTSGRQHTTF
SAESSRSLLICLLWVLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFER
MNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMT
HWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLK
VLLHSMACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSIGTIR
SHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEE
DLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLT
WLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEES
AVSDDVVSPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANR
DAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITK
LAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRI
TYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEII
LTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIP
SDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLI
NRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL
NT seq 6396 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgcgcctttgcccagaagatcagcagaactgtggctgctgaagttagg
aagcagatttctggacagtacagtggttctccccaactgctcaaaaacctcaacattgtt
ggcagtatatcccatcataccacagtgccccttactgaagcagtggatccagtggatttg
gaagattacctcattactcatcctttagctgtggattctgggcttttaagggatttgatt
gaattccctccagatgatattgaagtggtttatagtcctagggactgtagaacccttgtt
tcagctgtacctgaagaaagtgaaatggatccacatgttagagattgtataagaagttat
acagaagactgggcaattgtgatcagaaaatatcataaactgggaacaggatttaatcct
aatacattagataaacagaaagaaaggcaaaaaggtttgccaaaacaggtctttgaatcc
gatgaagctccagatggcaacaactaccaggatgaacaagatgatcttaaaagacgttca
atgtcaatagatgatactccaaggggtagctgggcctgcagtatttttgacttgaaaaat
tcacttcctgatgctttgcttcccaatttacttgatcgaactccaaatgaagaaatagac
cgtcagaatgatgaccaaaggaaagcaaaccgtcataaggaactctttgccttgcatcca
tcaccagatgaggaagaaccaatagaacgacttagtgttcctgaggtgcccaaagaacat
tttggtcaaagacttcttgtaaaatgtttatcactcaagtttgagattgaaattgaaccc
atttttgcaagtttggctttatatgatgtgaaggaaaagaaaaagatttcagaaaacttt
tattttgaccttaattctgagcagatgaaaggattattacgtccacatgtaccacctgct
gccattaccaccctggcacgatcagcaattttttctatcacttatccttcccaagatgtt
tttcttgtaataaagctagaaaaagtgctacagcaaggagacattggagagtgtgcagaa
ccatatatgattttcaaagaagcagatgccaccaagaataaggaaaaattggagaagctg
aaaagtcaagctgatcagttttgccaaagacttgggaagtatcgcatgccttttgcttgg
actgcaatccatttaatgaatattgttagcagtgctgggagtttggaaagagattctaca
gaggtggaaataagcactggagaacgaaaggggtcttggtcagagaggaggaattctagt
ctggttggcagaagatcacttgaaaggacaacaagtggagatgattcttgtaacttgacc
agctttcgacctgctactctcacagtgacaaatttttttaagcaggaaggagatcgctta
agtgatgaagatctatacaaattccttgctgatatgagaaggccatcttctgttttacgg
cgactaagacctattacagctcagctgaagatagacatttctcctgcacctgaaaatccc
cattattgcctaacaccagagctgcttcaagtgaagctttaccctgacagtagagttaga
cctaccagagaaattttggagtttcctgcaagggatgtctatgttccaaacactacttac
agaaaccttctctacatataccctcagagtctcaattttgccaaccgtcaaggttctgcc
agaaatataacagttaaagtccagtttatgtatggggaggatcctagcaatgccatgccg
gtaatctttggtaaatctagctgttcagaattttcaaaggaagcctatacagccgtagta
tatcataacaggtctcctgattttcatgaagaaatcaaggttaaactccctgctacttta
actgaccatcatcacttgctttttactttttatcatgttagttgtcaacaaaaacaaaat
actcctcttgaaactcctgttggatacacgtggataccgatgcttcagaatggacgatta
aagactgggcagttttgcctaccggtctcactggaaaaaccgccacaggcttattctgta
ctgtctcctgaggttcctctacctggcatgaaatgggtagataatcacaaaggtgttttt
aatgttgaagttgttgctgtttcatctatccatacacaggatccttatcttgataagttt
tttgctctggtgaatgctctggatgaacacatgttcccagtccgaattggagacatgcga
atcatggaaaacaacttagaaaatgaattgaagagcagtattgcagcattgaattcatct
cagttggaaccagtggtccgatttctttatcttctgcttgataaactgatacttttagtt
gttagacctcctgtcattgctggccaaatagtaaatctaggtcaagcatcatttgaagcc
atggcatcaattataaatcggcttcacaaaaacttggaaggaaatcatgaccagcatggc
agaaacagccttctcgcatcatatatctattatgtttttcgcctaccgaatacttaccct
aattcaccatcaccaggtcctgggggtttgggaggatcagtgcattatgccacaatggct
agatctgctgtgagacctgcaagccttaatttaaatcgttctcggagccttagtaatagt
aatccagatatatctggaactcccacgtcaccagatgatgaagtacggtcaatcatcggc
agtaagggtttagaccgctccaattcctgggttaacactggtggtccaaaagctgcccca
tggggatccaaccccagtccaagtgcagaatcaacacaggctatggatcgaagttgtaat
cgtatgtcttcgcacacagagacgtcaagtttcttacaaacattaacgggacgcttacca
actaaaaagctatttcatgaggagctggctttgcagtgggttgtttgcagtggcagcgtt
cgggaatcagctttgcaacaagcctggttcttttttgagttaatggtaaagagcatggtg
caccatttatactttaatgataaacttgatgcaccaaggaaaagtcgttttccagaacgt
ttcatggatgacattgctgctcttgtcagcacaattgctagtgatatagtttcacgattt
cagaaggacacagaaatggttgagagactcaacacaagccttgcattctttctcaatgat
ctgttgtctgttatggacagaggatttgtgtttagccttataaagacctgctataaacag
gtatcttcaaagctttattcattaccaactccaagtgtcttggtgtccctgaggctggat
tttctgcgcatcatcagcagccatgagcactatgttaccttaaacttaccctgcagcctg
ctaactccacctgcatcgccatcaccttctgtttcttctgcaacatctcagagttctgga
ttttccaccactgtgcaagaccagaagattgcaaatatgtttgaattgtctgtgcctttc
cgccagcaacattatttggcaggacttgtgttaacagagctggctgtcattttagatcct
gatgctgaaggactgtttggattgcataagaaagtcatcaatatggtacacaatttacta
tccagtcacgactcagacccacggtactctgacccccagataaaggctcgggtggctatg
ttgtatctacctctgattggcattatcatggaaactgttcctcagctgtatgattttaca
gaaactcacaatcaacgaggaagaccaatctgtatagccaccgatgattatgagagtgag
agcggaagcatgataagccagacagttgccatggcaattgcaggaacatcagttcctcag
ctaacaaggcccggcagtttcctcctcacatcaacgagtggcagacaacacactaccttt
tcagcagaatcaagtcggagtcttttgatctgtctgctttgggttctcaagaatgcagat
gagacagttttacaaaagtggtttacagatctctcagtcctgcagctaaaccggctatta
gatctgctttatctttgtgtatcttgctttgagtacaaaggaaagaaagtgtttgaaaga
atgaatagtttgacctttaagaaatcaaaggacatgagagcaaagcttgaggaagctatt
cttggaagcataggtgctaggcaagaaatggtgcgccgaagccgaggacagcttgagaga
agcccatctggaagtgcctttgggagtcaagaaaatctgaggtggaggaaggatatgact
cactggcgtcaaaacactgagaagcttgacaagtcaagagcagagattgaacatgaagca
ctgattgatggaaatctggctactgaagcaaatctaatcattttggatacattagagatt
gttgtccagacagtttctgtaacagaatccaaagagagcatccttggtggggtgctgaaa
gtgctactacatagcatggcctgtaatcaaagtgcagtttatctacaacactgttttgct
acccagagagccctggtttcaaagttccctgaactcttgtttgaagaggagacagagcag
tgtgctgatttatgcctccggcttctccggcactgtagcagtagcatcggtacaatacgg
tcacatgctagtgcctccctttacctacttatgagacagaactttgagattgggaataac
tttgccagggttaaaatgcaggtaaccatgtcactgtcttccttggtgggcacatctcag
aattttaatgaagaattcttaagacgttctctaaagactatactgacatatgctgaagaa
gacttggaattgagggagacaacatttcctgatcaggtccaagatttggttttcaacctc
catatgatcctctctgatactgttaaaatgaaggaacaccaggaggatcctgaaatgttg
attgatctaatgtacagaattgccaaggggtaccagacctctccagacctgcggctgacc
tggttgcagaacatggctggcaaacactcggaacgcagcaatcatgctgaagctgcccag
tgcctcgttcactcagcagcacttgttgctgaatatctgagcatgctggaggaccggaaa
tatcttcctgtgggatgtgtaacatttcagaatatttcatctaatgttttagaagaatct
gcagtctcagatgatgtggtatctccagatgaagaaggtatctgctctggaaagtacttt
actgagtcaggacttgtgggattactggaacaagcagctgcttctttctctatggctggc
atgtatgaagcagttaacgaggtttacaaagtacttattcctattcatgaagctaatcgg
gatgcaaagaaactatccacgattcatggtaaacttcaagaagcattcagcaaaattgtt
catcagagtactggctgggagcggatgtttggcacctattttcgtgttggtttttatgga
accaagttcggggatttggatgaacaggaatttgtttacaaggagcctgcaataaccaaa
cttgcagagatatctcacagattggagggattttatggagaaagatttggagaggatgtg
gttgaagtaatcaaggattctaatcctgtagacaagtgtaaattagatcctaacaaggca
tatattcagattacctacgtggagccatactttgacacatatgagatgaaggacagaatc
acatattttgacaaaaattataatcttcgtcgtttcatgtactgtacacccttcacttta
gatggtcgtgcccatggggaacttcatgaacaattcaaacggaagaccattctgactact
tctcatgcctttccttatattaagacaagggttaatgtcactcacaaagaggagatcatc
ttaacaccaattgaagttgctattgaagacatgcagaaaaaaacgcaggagttggcattt
gccacacatcaggatccagcagaccccaaaatgcttcagatggtactccagggatctgta
ggcacaacagtgaatcaggggcctttggaagttgcccaggttttcctgtctgaaataccc
agtgacccaaagctcttcagacatcataataaattgcgactctgcttcaaagattttact
aaaaggtgtgaggatgccttaagaaaaaataagagcttaattgggccagatcaaaaggag
tatcaaagggaactggagagaaactatcatcgccttaaagaggccctacagcctctgata
aacagaaagatccctcagttatacaaggcagtattacctgttacctgccacagggattcc
ttcagtcgaatgagcctgcgcaaaatggatctctaa

DBGET integrated database retrieval system