KEGG   Delphinapterus leucas (beluga whale): 111178528
Entry
111178528         CDS       T05885                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111178528 (AHRR)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111178528 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 111178528
NCBI-ProteinID: XP_022436998
UniProt: A0A2Y9P4A3
Position
Unknown
AA seq 693 aa
MIPPGECLYAGRKRRKPIQKQRPAVGAEKSNPSKRHRDRLNAELDRLAGLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQQPAAGAPSPEDRDPRGGSAVLEGRLLLESLHGFALV
VSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQAGCGQN
LLSETGEDAVLGRLLRAQEGAAGWPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLK
FLFGQKRRAPSGAALPPRLSLFCVVAPLPTAVKMQSVCLRAKHRVDASATPDAKAKAAAS
LCEPELHGKPSYLAGRGSGGNGLSVFRRPADACHWGRLATRGPCLCLRGGHDLLHPHPEG
AAGDGRGEELGGVPRGPSCPRERRDIPPYSCHLETQGPSKHLNWTPGRHGQDGGAKLKLE
PGKGDPFPAAQARGACLPYPGTQGTVHAVRSSPGSHQPKPPPGPCASRTSRALRDGHQGQ
APLPTSCPFPQGSLEDGLPRPGRQRLPVGCYPTEDKLRGIPMPPGAPCNPMLSLDVPIKM
ESESGSEDAADGYCVSPSQAWLGASDVAKRQLVTFPTRMHLKMEPDSRHPLYSPPLGPGL
LGAHPRPGRELAPLHPAHCACLEPPSRLCAGGHQPPSLGCDCQAPGPVPVVKLEPLDSPP
WAAHGQGGAPGMLPRSTLATRMPPRDPECMFLP
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgattccgccgggagagtgcctgtatgccgggaggaaaagaaggaagcccattcagaaa
cagaggcccgccgtgggcgccgagaagtcgaacccttccaagagacaccgggatcgcctc
aacgccgagctggaccgcctagccggcctgctgccactgccccccgacatcatctctaag
ctggacaagctttcggtcctgcgcctcagcgtcagttacctccgggtgaagagcttcttc
caagccctgcagcagccggcggccggtgccccctcaccagaagacagggatccgcgtgga
gggtctgccgtgctggagggaaggctgctactggagtccctccacggctttgctctggtg
gtaagcgcagaagggatgatattctacgcgtcagcaacgattgtggactatctgggcttc
caccagacggacgtgatgcaccaaaatatttacgactacatccacgtggacgaccgccag
gacttctgccggcagctgcactgggccatggaccctccccaggctgggtgtgggcagaac
ctgctctcagagacaggagaggacgccgtcctggggaggctgctccgggcccaggagggg
gccgcgggctggcccaccgagtactcggccttcctgacgcggtgcttcatttgccgcgtg
cgctgcctgctggacagcacctcgggcttcctgacgatgcagtttcaagggaaactaaaa
ttcctgttcgggcagaagaggagggccccgtcgggagccgccctgccccctcggctctcc
ctgttctgcgtcgtggcgcccctgcctactgcggtgaagatgcagagtgtgtgtctgagg
gcgaagcacagggtggacgcctcggccacgccggacgcaaaagcaaaagctgccgcaagt
ctctgtgaaccagaattgcacggaaaacccagttacttagcagggaggggcagcggagga
aacggcctgtccgtgttcaggaggcccgcagacgcctgccactggggccggctggcaacc
cggggcccctgcctgtgcctgcggggcggccacgacctcctccacccccaccccgagggg
gccgcaggggatgggcgaggagaggaactggggggggtgccgaggggcccctcctgccca
agggagcggagggacatccccccgtacagctgccacctcgagacacagggaccctcgaag
cacctgaactggacgccggggagacacggtcaggacggcggcgccaagctgaagctggag
cccggcaagggtgacccattccctgccgcgcaggcccgtggcgcctgcctgccctacccg
ggcacccagggcactgtccacgccgtcaggagttcacctggctctcaccagccaaagcct
ccccccgggccctgcgccagccggaccagcagagccttgcgggatggccaccagggccag
gctccccttcccaccagctgccccttccctcaggggagcctggaggacgggcttcctcgg
ccgggaaggcagcgtctccccgtggggtgctatcccaccgaggacaagcttcgaggcatc
ccaatgcccccgggagccccgtgtaaccccatgttgtcactcgatgtgcccatcaagatg
gagagtgaatccgggtccgaggatgcggcggatggctactgtgtgtccccgagccaggcg
tggctgggggccagcgacgtggccaagagacagctggtcactttccctaccaggatgcac
ctgaagatggagccggactccaggcaccccctctacagcccacccctggggcccggcctg
ctgggggcccaccccaggcctggcagggagctggccccgttgcaccccgcacactgcgcc
tgcctggagcctccgtcccgcctctgtgctgggggccaccaaccccccagcctgggctgt
gactgccaggctcctgggcctgtgcctgtagtcaagcttgagcccctggactcgcccccg
tgggccgctcacggccagggcggggcgcccgggatgctccccaggagtaccttggcgaca
cggatgccacccagagaccccgagtgcatgttcctgccgtaa

DBGET integrated database retrieval system