KEGG   Delphinapterus leucas (beluga whale): 111179846Help
Entry
111179846         CDS       T05885                                 

Gene name
NT5C3A
Definition
(RefSeq) cytosolic 5'-nucleotidase 3A isoform X1
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00230  Purine metabolism
dle00240  Pyrimidine metabolism
dle00760  Nicotinate and nicotinamide metabolism
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111179846 (NT5C3A)
   00240 Pyrimidine metabolism
    111179846 (NT5C3A)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111179846 (NT5C3A)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     111179846 (NT5C3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UMPH-1 HAD Metallophos_3 zf-ANAPC11 CIDE-N
Motif
Other DBs
NCBI-GeneID: 111179846
NCBI-ProteinID: XP_022439484
UniProt: A0A2Y9NWV6
Position
Unknown
AA seq 331 aa AA seqDB search
MDRSAVARVSAVASASVCAVVAGAVLAQYIFTLKRKTGRKTKIIEMMPEFQKNSVRIKNP
TRVEEIICGLIKGGPAKLQIITDFDMTLSRFSYRGKRCPSCHNVIDNCKLITDECREKLL
QLKEKYYAIEIDPVLTVEEKYPYIVEWYTKSHGLLVEQALPKAKLKEIVEESDIMLKEGY
ENFFDKLQQYSIPVFIFSAGIGDVLEEVIRQAGVYYPNVKVVSNFMDFDDNGLLRGFKGE
LIHVFNKHDGSLKNTEYFNQLKNNSNIILLGDSQGDLKMADGVANVGHILKIGYLNDRVD
ELLEKYMDSYDIVLVKDESLDVANSILQKIL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatccgcggtggcgagggtgagcgcggtagcgagcgccagcgtgtgcgccgtc
gtggcgggggcggtgctggcccagtacattttcaccttgaagagaaagacgggccggaag
accaagatcatcgagatgatgccagaattccagaaaaattcagttcgcatcaagaatcct
acaagagtagaagaaattatctgtggtcttatcaaaggaggacctgccaaacttcagata
ataacagactttgatatgacactgagtcgattttcctacagagggaaaagatgcccatca
tgtcataatgtcattgacaactgtaagctaattacagatgaatgtcgagaaaagttactg
caactaaaggaaaagtattatgctattgaaattgatcctgttcttactgtagaagagaag
tacccttatatagtagagtggtatactaaatcacatggtttgcttgttgaacaggcttta
ccaaaagccaaacttaaagaaattgtggaagaatctgacattatgctcaaggaaggatat
gagaatttctttgataagctgcaacagtacagtattcctgtgttcatattctcagctggt
atcggtgatgtactagaggaggttatccgtcaagctggtgtttattatccaaatgtcaaa
gtagtgtccaacttcatggattttgatgacaacgggctgctcagaggatttaaaggagaa
ctaattcatgtgtttaacaaacatgatggatccttgaagaatacggaatatttcaatcaa
ctaaaaaacaatagcaacataattctgctgggagactcccaaggggacttaaaaatggca
gatggagtagccaatgttggacacattctgaaaattggatatctaaatgatagagtggat
gagcttttagaaaagtacatggactcttatgatattgttctagtaaaagatgaatcattg
gatgtagccaactctatcttacagaagattctataa

DBGET integrated database retrieval system