KEGG   Delphinapterus leucas (beluga whale): 111181016Help
Entry
111181016         CDS       T05885                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04260  Cardiac muscle contraction
dle04261  Adrenergic signaling in cardiomyocytes
dle04921  Oxytocin signaling pathway
dle05410  Hypertrophic cardiomyopathy (HCM)
dle05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
dle05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111181016 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111181016 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111181016 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    111181016 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    111181016 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    111181016 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    111181016 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dle04040]
    111181016 (CACNG7)
Ion channels [BR:dle04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111181016 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Amastin Claudin_3 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 111181016
NCBI-ProteinID: XP_022441733
UniProt: A0A2Y9PGG7
Position
Unknown
AA seq 275 aa AA seqDB search
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtcactgcagtagccgcgccctgaccctgctgagcagcgtgtttggtgcgtgtggc
ctgctgcttgtgggcattgcggtcagcacggactactggctgtacatggaagagggaacg
gtgttgccacagaaccagaccacggaggtcaagatggcgctgcatgctggcctatggcgc
gtctgcttcttcgcaggccgggaaaagggtcgctgcgtggcctcagaatatttccttgaa
ccggagatcaacttggtgacggaaaacacggagaatattctgaagacagtgcgcacagcc
acccccttccccatggtcagcctcttcctcgtgttcaccgccttcgtcatcagcaacatc
ggccacatccgcccacagaggaccattctggccttcgtttctggcatcttcttcatccta
tcgggcctctccttggtggtgggcttggttctttacatttccagcatcaacgacgaggtc
atgaacaggcccagcagctctgagcagtatttccactatcgctacgggtggtcttttgcc
ttcgcagcttcctccttcctactcaaagagggagctggcgtgatgtccgtgtacttgttc
accaagcgctacgcggaggaggagatgtaccgtccgcacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagtttctgcagcccgaggcgtggcgccgcggc
cgcagtccctccgacatctctagcgacgtatccatccagatgacgcagaactaccctcca
gccatcaagtacccggaccacctgcacatctccacctcgccctgctga

DBGET integrated database retrieval system