KEGG   Delphinapterus leucas (beluga whale): 111181452Help
Entry
111181452         CDS       T05885                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04022  cGMP-PKG signaling pathway
dle04024  cAMP signaling pathway
dle04062  Chemokine signaling pathway
dle04071  Sphingolipid signaling pathway
dle04270  Vascular smooth muscle contraction
dle04350  TGF-beta signaling pathway
dle04360  Axon guidance
dle04510  Focal adhesion
dle04530  Tight junction
dle04611  Platelet activation
dle04670  Leukocyte transendothelial migration
dle04810  Regulation of actin cytoskeleton
dle04921  Oxytocin signaling pathway
dle05132  Salmonella infection
dle05135  Yersinia infection
dle05163  Human cytomegalovirus infection
dle05200  Pathways in cancer
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111181452 (ROCK1)
   04071 Sphingolipid signaling pathway
    111181452 (ROCK1)
   04024 cAMP signaling pathway
    111181452 (ROCK1)
   04022 cGMP-PKG signaling pathway
    111181452 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111181452 (ROCK1)
   04530 Tight junction
    111181452 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111181452 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111181452 (ROCK1)
   04670 Leukocyte transendothelial migration
    111181452 (ROCK1)
   04062 Chemokine signaling pathway
    111181452 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111181452 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111181452 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    111181452 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111181452 (ROCK1)
   05206 MicroRNAs in cancer
    111181452 (ROCK1)
   05205 Proteoglycans in cancer
    111181452 (ROCK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111181452 (ROCK1)
   05135 Yersinia infection
    111181452 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    111181452 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111181452 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111181452 (ROCK1)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111181452 (ROCK1)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   111181452 (ROCK1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111181452 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 Cortex-I_coil HR1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 111181452
NCBI-ProteinID: XP_022442506
UniProt: A0A2Y9PB74
Position
Unknown
AA seq 1354 aa AA seqDB search
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNENRTSSNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSHLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSITQLESLNRELQERNRILENSKSQMD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLSLQLEQES
NKRLLLQNELKTHAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENSKKIQELQSEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKEHTVSRLEETNSMLTKDIELLRKENE
ELTDKMKKAEEEYKLKKEEEINNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcagattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatccgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaacagtccttgggttgttcagctattt
tatgcattccaagatgatcgttatctctacatggtaatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcccgattttatactgca
gaagtagttctggcattggatgcaatccattccatgggttttattcatagagatgtgaag
cctgataacatgctgctggataagtctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttgggacacctgattat
atttcccctgaagtattaaaatctcaaggtggtgatggttattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacaccattttatgca
gattctctggttggaacttacagtaagattatgaaccataaaaattcacttaccttccct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaggtgagattagggcggaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gatcagtgggcttgggaaacactccgagacactgtagcgccagttgtacctgatttaagt
agtgacattgacacaagtaactttgatgacttggaagaagataaaggagatgaagaaaca
ttccctatacctaaagcttttgttggcaatcaactaccctttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgaaaacagaactagctctaatgtg
gataaaagcttgcaggaaaatttgcaaaaaacaatttataagctggaagaacagttgcat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttcaaacataaaactc
gacaagataatgaaagaattggatgaagaggggaatcaaagaagaaacctagaatctaca
gtgtctcagattgagaaggagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagcagaacaggaaaatgagaagaggaggaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtcagtcagaattcacaccttgctaatgagaagctg
gcacaattacaaaagcagctagaagaagccaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcacaccgagatgagcaaatcaattactcagctagagtcc
ctgaatagagaattgcaggagagaaatagaattttggagaattccaagtcacaaatggac
aaggattattaccagctgcaagctgtattagaagctgaacgaagagacagaggtcatgat
tctgagatgattggagacctacaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataaccttgaaagagtggaaggagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaataacttagaaatagatttaaactacaagcttaaatcatta
cagcaaaggttagaacaagaggtaaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggccaagtctgttgcaatgtgtgagatggaaaaaaagctg
aaggaagagagggaagctcgagagaaggctgaaaatagggttgttcagattgagaagcag
tgctccatgctagatgttgatctaaaacaatctcagcagaagctagagcatttgactgaa
aataaagaaaggatggaggatgaagttaagaatctatccctgcaactggagcaggagtca
aataagcgactgttgttacaaaatgaattgaagacccacgcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagagtttgaattagctcagcttacaaaacaatacagaggaaatgaaggacagatgcgg
gagctacaagatcagcttgaagctgagcaatatttctcgacactttataaaacccaggta
aaggaacttaaggaagaaattgaagaaaaaaacagagaaaattcaaagaaaatacaggaa
ctacaaagtgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagccgag
tctgagcagttggctcgagggcttctggaagaacagtattttgaattgacccaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagagcacactgttagtcgg
ctcgaagaaacgaacagtatgctaaccaaagatattgaattattaagaaaagaaaatgaa
gagctaactgataaaatgaagaaggcagaggaagaatataaactgaagaaggaggaggag
atcaataatcttaaggctgcctttgaaaagaatatcaatacagaacgaacccttaaaacg
caggctgttaacaagttggcagaaataatgaatcggaaagactttaaaattgacagaaag
aaagctaatacacaggatttgagaaagaaggaaaaggaaaatcgaaagctacaacttgaa
ctcaaccaggaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtacacataggaatgagcttcagatgcagttg
gctagcaaagagagtgacattgagcaattgcgtgcgaaacttttggacctatcagattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaaccttccagaatcaaga
attgaaggttggctttcaataccaaatagaggaaatatcaaaagatacggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttttataatgatgaacaagataaggaa
caatccaatccatctatggtattggacattgataaattgtttcatgttcgtcctgtaact
caaggagatgtgtacagagctgaaactgaagaaattcctaaaatattccagatactatac
gcaaatgaaggtgaatgtagaaaagacgtagagatggaaccagtacaacaagctgagaaa
actaattttcaaaaccacaaaggtcatgagttcattcctaccctctaccactttcccgcc
aactgtgaggcctgtgccaaacctctctggcatgtttttaagccaccccctgccctggaa
tgtcgaaggtgccacgttaagtgccacagagatcacttagataagaaagaggacttaatt
tctccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgctactagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaagattcctaagaatcca
ccatctggttttgttcgtgcgtcgcctcgaacactttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system