KEGG   Delphinapterus leucas (beluga whale): 111181702Help
Entry
111181702         CDS       T05885                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00564  Glycerophospholipid metabolism
dle00565  Ether lipid metabolism
dle00590  Arachidonic acid metabolism
dle00591  Linoleic acid metabolism
dle00592  alpha-Linolenic acid metabolism
dle01100  Metabolic pathways
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04072  Phospholipase D signaling pathway
dle04217  Necroptosis
dle04270  Vascular smooth muscle contraction
dle04370  VEGF signaling pathway
dle04611  Platelet activation
dle04664  Fc epsilon RI signaling pathway
dle04666  Fc gamma R-mediated phagocytosis
dle04724  Glutamatergic synapse
dle04726  Serotonergic synapse
dle04730  Long-term depression
dle04750  Inflammatory mediator regulation of TRP channels
dle04912  GnRH signaling pathway
dle04913  Ovarian steroidogenesis
dle04921  Oxytocin signaling pathway
dle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111181702 (PLA2G4E)
   00565 Ether lipid metabolism
    111181702 (PLA2G4E)
   00590 Arachidonic acid metabolism
    111181702 (PLA2G4E)
   00591 Linoleic acid metabolism
    111181702 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    111181702 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111181702 (PLA2G4E)
   04010 MAPK signaling pathway
    111181702 (PLA2G4E)
   04370 VEGF signaling pathway
    111181702 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    111181702 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111181702 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111181702 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    111181702 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    111181702 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111181702 (PLA2G4E)
   04913 Ovarian steroidogenesis
    111181702 (PLA2G4E)
   04921 Oxytocin signaling pathway
    111181702 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111181702 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    111181702 (PLA2G4E)
   04726 Serotonergic synapse
    111181702 (PLA2G4E)
   04730 Long-term depression
    111181702 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111181702 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    111181702 (PLA2G4E)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111181702 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 111181702
NCBI-ProteinID: XP_022443091
UniProt: A0A2Y9PCS9
Position
Unknown
AA seq 868 aa AA seqDB search
MTIQTSEGHPGSGTDVFVLQSLQGDEEGSTAGRSVSDLEQTQVLETPHLPPLLPMAPGGS
QEELSPCHLLTVRVIRMKNVQQADVVSLTDCFVSLWLPTSSHKRLRTRTISNCRNPEWNE
SFKFQIQTQVKNVLELSVCDDDTVTPDDHLLTVLYDLTKLCFREKTHVKFPLNTEGMEEL
EVEFLLEESPSPPESLITNGVLVSRQMSCLEVHAESRRQKNRKMKDLLVTVTESFEHTQH
ISCCLEPCGPNPACFHYPKYFQPQIHVEVPKSQWSSVLCRCNACKNDPVCQSLDCLPDGQ
AVTLPVNKNCELHMKSTPCSEALDVRLGFSLCQAELEFLQKRRVVVAEALKQVLQLEEDL
QADEVPLISIMATGGGTRSMTAMYGHLLGLQKLNILNCASYITGLSGATWTMATLYRDPD
WSSKNLELAILEARRHVVKDKMPALFPDQLLKFREELQQRRQEGYKVTFTDFWGLLVEAC
LGDERYECKLSDQSAALCQGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGLQKYGAF
IPTELFGSEFFMGRLMRRIPESRMCYMLGLWSSIFSLNLLDAWNLSHTSEEFFHRWTRER
VHDIEDEPLLPEIPKCDANMLDTTVVTPGSWLSNTFRNILTSRAFVSEFHNFLLGLQMHT
DYYQNGQFSTWKDSVLDGFPNKLTASVNHLCLLDTAFVINSSYPPILRPERKADLIIHLN
YCAGSQTKPVKQTCKYCTEQNIPFPKYEVQEEEDNLKECYLMESSQEPDAPTVIFFPLIS
DTFQKYKAPGVERSPEELEQGQVDIYGPKSPYATKELTYTEAAFDKLVKLSEYNILNNKD
KLLQALRLAVEKKKRLKSQCPPKVPGHS
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgactatccagacctcagaaggccatcctggctcgggaactgatgtgtttgtcctgcag
agcctacaaggggatgaagaaggcagcacagcaggaaggagtgtcagtgatttggagcag
acacaggtcttggaaactccccatctcccacctctacttcccatggcccctgggggctct
caggaggagctgtctccatgccacctgctgacagtgagggtcatccggatgaaaaacgtc
caacaggctgacgtggtaagcctgacagactgctttgtgagcctctggctgcccaccagc
tctcataagaggctgaggactaggaccatctccaactgccgaaacccagagtggaatgaa
agcttcaagttccagatccagacccaggtgaagaacgtgctagagctgagcgtctgtgat
gatgacacggtgacaccagatgaccatttattgacagttctctatgacctcaccaagctc
tgcttccgagagaaaacccacgtgaagttcccactcaacacagagggcatggaggagctg
gaggtggagttcctgctggaggagagcccctctccacctgagagtctcatcacgaatggc
gtgctggtgtctcgacaaatgtcctgcctggaggttcatgcagaatccaggagacagaag
aataggaaaatgaaggacctcctggtgacagtaacagagtccttcgagcacacccagcac
atctcatgctgcctggagccctgcggcccaaaccctgcctgcttccactaccccaagtac
ttccagccccagatccacgtggaggtgcccaagagccagtggagctctgtgctttgccgc
tgcaatgcgtgcaagaacgaccctgtgtgccagtccctggattgcctccctgacggccag
gcggtgaccctgcctgtgaacaagaattgtgaattacacatgaagtctacaccctgctcc
gaggcactggacgtgcggctaggcttcagcctgtgccaggcagagctggagttcctgcag
aagcggagggtggtggtggctgaggcgctgaagcaggtgttgcagctggaggaggacctg
caggcagacgaggtcccactgatatccatcatggccactgggggtgggacaagatccatg
actgccatgtatggccacctgctggggctgcagaagctgaacatcctgaactgtgccagc
tacatcactggcctgtcaggggccacctggaccatggctaccttgtaccgtgaccctgac
tggtcctccaaaaacctggagcttgccatcctcgaggcgcggaggcacgtagtcaaggac
aagatgcccgctctgttcccagatcagctcctcaaattccgggaggagctgcagcagcgc
aggcaggaaggctacaaagtcaccttcacagacttctggggtctgctagtcgaggcctgt
ctgggggacgagagatatgaatgcaaactgtcagatcagagtgctgctttgtgtcagggc
cagaaccccctgcccatctacctcaccatcaatgtaaaggatgacgtaagcaaccaggat
ttcagagagtggttcgagttctccccctacgaggtgggcctgcagaagtatggagccttc
attcccaccgagctcttcggctccgagttcttcatggggcggctgatgaggaggatccca
gagtcgcggatgtgctacatgctaggtctgtggagcagcatcttctccctgaacctgctc
gatgcctggaatttgtcccacacctcggaggagtttttccacaggtggacaagggagaga
gtgcatgatatagaagatgagccactcctacctgaaatccccaaatgtgatgccaacatg
ctggacaccacggtggtgacgccagggtcatggctgtccaatactttccgcaacatcctc
acctcccgggcctttgtgtctgagttccacaacttcctgctggggctgcagatgcacact
gactactaccagaacggccagttctccacgtggaaggactcggtgctagatggcttccca
aacaagctgacagcgtccgtgaaccacttgtgcctgctggacactgcattcgtcatcaac
tccagctacccgcccatcctcaggccggagagaaaagctgacctcatcatccacctcaat
tactgtgctgggtcccagacaaagcccgtgaaacaaacctgcaagtactgcaccgagcag
aacatccccttccccaaatatgaggtgcaggaggaggaggataacctcaaggagtgctac
ctgatggagagctcccaggagcccgatgcccccactgtgattttcttcccactcatcagt
gacaccttccaaaagtacaaggccccaggtgtggagcgaagccccgaggagctggagcag
ggccaggttgacatctatggtcccaaatctccctacgccaccaaggagctgacgtacaca
gaggccgccttcgacaagctggtgaagctctccgaatataacatcctgaataacaaggac
aagctccttcaggccttgcgactagcagtagagaagaagaaacgcctgaagagtcagtgt
ccccctaaagtcccaggacactcgtaa

DBGET integrated database retrieval system