KEGG   Delphinapterus leucas (beluga whale): 111182192Help
Entry
111182192         CDS       T05885                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111182192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dle03012]
    111182192
Translation factors [BR:dle03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    111182192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 111182192
NCBI-ProteinID: XP_022444095
UniProt: A0A2Y9PDX4
Position
Unknown
AA seq 913 aa AA seqDB search
MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPEQSADEDAEKNEEDSEG
SSDEDEDDEGVSASTFLKKKSEAPSSESRKFLKKMEDEDEDSEDSEDDEDWDTGSTSSDS
DSEEEEGKQTVLASRFLKKAPTTEEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGE
WERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQI
ASENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWQKCLDCINELMDILFANPNIFV
GENILEESENLQNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVC
TIIERVQRYLEEKGTTDEICRIYLRRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENE
GEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQH
ADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQ
EQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRV
GERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRSMLV
RKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQ
TVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMR
RGGYRQQQSQTAY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggttttttaccaccggttcggacagcgagtccgagtcgtccctgtccggggag
gagctcgtcaccaaacctgtcgggggcaactacggcaaacagccgttgttgctgagtgag
gatgaagaagataccaagagagttgtcagaagcgccaaggataagaggtttgaggaactg
accaaccttatccggaccatccgtaatgccatgaagattcgggatgtcaccaagtgcctg
gaagagtttgagctcctaggaaaagcatatgggaaggctaagagcattgtggacaaggaa
ggtgtcccccggttctatatccgaatcctggctgacctggaggactatcttaatgagcta
tgggaagataaggaagggaagaagaagatgaacaagaataatgccaaggccctgagcacc
ctgcgccagaagatccgaaaatacaaccgagattttgagtcccatattacaaattacaag
cagaaccctgagcagtctgcagatgaagatgccgagaagaatgaggaggattcagaaggc
tcttcagatgaggatgaggatgatgaaggagtcagtgcttccactttcctaaagaagaaa
tcagaagctccttctagcgagagtcggaagttcctcaaaaagatggaggatgaagatgag
gactcagaagattcagaagatgatgaagattgggacacaggttccacatcttctgattca
gattcagaggaggaagaagggaaacagacagtgctggcgtcgagattccttaaaaaggcc
cccaccacagaggaggacaagaaggcagctgagaagaaacgggaggacaaagccaagaag
aagcacgataggaaatccaagcgcctggatgaggaggaggaagacaatgaaggcggggag
tgggaaagggtccggggtggagtgcccctggttaaggagaagccaaaaatgtttgccaag
ggaactgagatcacccacgctgttgtcatcaagaaactgaatgagatcctacaggcacga
ggcaagaagggaactgatcgtgcagcccagattgagctgctacagctgctggttcagatt
gcttctgaaaacaacctgggagagggtgtcatcgtcaagatcaagttcaatatcatcgcc
tctctttatgactacaaccccaacctggccacatacatgaagcctgagatgtggcagaag
tgtctggactgcatcaatgagctgatggatatcctgtttgcaaaccccaacatctttgtt
ggagagaacattctggaagagagtgagaacctgcaaaacgctgaccagccgctgcgtgtc
cgtggctgtatcctaactctggtggaacgaatggatgaagaatttaccaagataatgcaa
aacactgatcctcactcccaagagtacgtggagcacctgaaggacgaggcacaggtgtgc
accatcattgagcgtgtgcagcgctacctggaggagaagggcaccactgacgagatctgt
cgcatctacttgaggcgcatcctccacacctactacaagtttgattacaaggcccatcag
cggcagcttaccccccctgagggctcctcaaagtcagagcaagaccaggctgaaaatgag
ggcgaggactcagctgtgctcatggagagactgtgcaagtacatctatgccaaggaccgc
acagaccgaatccgcacatgcgccatcctctgccatatctaccatcatgctctgcactcc
cgctggtaccaggcccgtgacctcatgctcatgagccacctacaagacaacattcagcac
gcggacccgccagtacagatcctgtacaaccgcaccatggtgcagctgggcatctgtgcc
ttccgccaaggcctgaccaaggatgctcacaatgccctgctggacatccagtcaagcggc
cgggccaaggagcttctgggccagggcctgctgctgcgcagcctgcaagagcgcaaccag
gagcaggagaaggtggagcggcgccggcaggtgcccttccacctgcacataaatctggag
ctgctggagtgtgtttacctggtgtcggccatgctcctggagatcccctacatggccgcc
catgagagtgacgcccgccgacgcatgatcagcaagcagttccatcaccagctgcgggtg
ggcgagcgacagcccttgctgggtccccccgagtcaatgagggaacacgtggtcgctgcc
tccaaggccatgaagatgggtgactggaagacctgccacagttttatcatcaacgagaag
atgaatggcaaagtgtgggaccttttcccagaggctgacaaagtccgaagcatgctggtt
aggaagatccaggaagagtcactgcggacctacctcttcacctacagcagtgtctatgac
tccatcagcatggagacactgtctgacatgtttgaactggacctgcccactgtgcactcc
atcatcagcaagatgatcattaacgaggagttgatggcctccctggaccagccgacacag
acagtggtgatgcaccgcactgagcccactgcccagcagaacctggcactgcagctggct
gagaagctgggcagcctggtggaaaacaatgagcgggtgtttgaccacaagcagggtacc
tatggtggctacttccgagaccagaaggatggctaccgcaaaaatgagggctacatgcgc
cggggtggctaccgccagcagcagtctcagacggcctactga

DBGET integrated database retrieval system