KEGG   Delphinapterus leucas (beluga whale): 111183108Help
Entry
111183108         CDS       T05885                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00480  Glutathione metabolism
dle00590  Arachidonic acid metabolism
dle01100  Metabolic pathways
dle04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111183108 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111183108 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    111183108 (GPX3)
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111183108 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 111183108
NCBI-ProteinID: XP_022445879
UniProt: A0A2Y9PG29
Position
Unknown
AA seq 226 aa AA seqDB search
MARLFRASCLLSLLLAGFVPPSRGQEKSKMDCHAGVGSSIYEYGALAIDGEEYIPFKQYA
GKYILFVNVASYUGLTSQYLELNALQEELAPFGLVILGFPCNQFGKQEPGMNSEILATLK
YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPDRLFWDPMKVHDIR
WNFEKFLVGPDGAPITRWHHRTTVNTVKMDILAYMRRRATLEAKGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctcttccgggcatcctgccttctctccctgctcctggccggcttcgttccg
ccgagccgaggacaggagaagtcgaagatggactgccatgctggggtgggcagcagcatc
tatgagtatggagccctcgccattgacggggaggagtacatccccttcaagcagtacgct
ggcaaatacatcctctttgtcaacgtggccagctactgaggcctgacgagccagtacctt
gaactgaatgcactacaggaagaacttgcaccatttggtctggtcattctgggcttcccc
tgcaaccaattcggaaaacaggaaccaggaatgaactcggagatcctagccactctcaag
tatgtccgaccaggtgggggcttcgtccccaatttccagctctttgagaaaggggatgtg
aacggggagaaagaacagaagttctacacattcctcaagaactcctgtcctcctacctcg
gagctcctgggctcaccggaccgcctcttctgggatcccatgaaggtccatgacatccgc
tggaactttgagaagttcctggtggggccggatggtgctcccatcacgcgctggcaccac
cgcaccacggtcaacactgtcaagatggacatcctggcctacatgcggcgccgggccacc
ctggaggccaaggggaagtaa

DBGET integrated database retrieval system