KEGG   Delphinapterus leucas (beluga whale): 111183143Help
Entry
111183143         CDS       T05885                                 

Gene name
MRPL22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial isoform X1
  KO
K02890  large subunit ribosomal protein L22
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    111183143 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dle03011]
    111183143 (MRPL22)
Ribosome [BR:dle03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    111183143 (MRPL22)
  Bacteria
    111183143 (MRPL22)
  Archaea
    111183143 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 111183143
NCBI-ProteinID: XP_022445932
UniProt: A0A2Y9PRD6
Position
Unknown
AA seq 226 aa AA seqDB search
MSPEGVCRRSLSGRDFAVFIHLSSQLGERLYDHYFELFIRLFSSHSVLPQSHIHTSASLE
ISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIQGMSIDQALAQL
EFSDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLYIAQSTSGRGQYLKRIRYHGRGRFGI
MEKVFCHYFVKLVEGPPPPPEAPKTAVAHAKEYIQELRNRTIIHTL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgaaggggtttgtcggaggagtctttctggaagagatttcgcggtgttcatc
catttgtcttcccagctcggtgagcgtctttatgaccattactttgaactctttatcagg
cttttttcatctcacagcgttttaccccaatcacatattcacacaagtgcttctcttgaa
atatctcgaaaatgggagaagaagaataaaattgtttatcctccacaactgcctggagaa
cctcggagaccagctgaaatctaccattgtcgaagacaaataaagtacagcaaagacaag
atgtggtatttggcaaaattgatacaaggaatgtccattgaccaggctctggctcagttg
gaattcagtgacaaaaaaggggcccagataattaaagaggttctcttagaagcacaagat
atggcagtgagagaccacaatgtggaattcagatccaatttatatatagctcagtccacc
tcagggcgaggccagtacctgaaacgcatccgataccacggcagaggtcgctttgggatt
atggagaaggttttttgccattattttgtgaagttggtggaaggccctccacctccacct
gaggcaccaaagacagcagtcgcccatgccaaagagtatatccaggagcttcgcaaccgg
accatcattcacactctatga

DBGET integrated database retrieval system