KEGG   Delphinapterus leucas (beluga whale): 111183349Help
Entry
111183349         CDS       T05885                                 

Gene name
IWS1
Definition
(RefSeq) protein IWS1 homolog isoform X1
  KO
K17498  transcription factor SPN1
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dle03021]
    111183349 (IWS1)
Transcription machinery [BR:dle03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111183349 (IWS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 111183349
NCBI-ProteinID: XP_022446269
UniProt: A0A2Y9PH60
Position
Unknown
AA seq 821 aa AA seqDB search
MDSEYYSGDQSADDGGATPVQDERDSGSDVEDDVNEQHSGSDTGSVERHSENEPSDREDG
LNKRHHVTDSENDDPSNLNASDSESEELQRQKDSDSEFEGHAEPPASDSENEDANHHGSD
SENEEPRKLPVSDSENEELLNGHASDSENEDVRKPPASDSEVEELPKSPASYSETEDALK
PQVSDSESEEPPRHPASDSENEELPKPRVSDSESEELPKPRISDSESEDPPRQQASDSEN
EELPKPRISDSESEDPPRHQASDSENEELPKPRISDSESEDPPRHQTSDSENEELPKPQA
SDSESEEPQKGPASDSEAEAAPGHRQKPVSDEDSDGENKREDTEMQADPLHSDAHVDRKR
FSSSDSEEEEPKRPKIDSDEDEEKEGVEEKVAKRKAAVLSDSDDEEKASTKKSRVVSDAD
DSDSDVMSDKSGKREKTIASDSEEEAGRELSDKKNEEKDLFGSDSESGNEEENLIADIFG
ESGDEEEEEFTGFNQEDLEEEKSETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKS
MSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPTVVMHL
KKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIG
RAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRM
NSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQ
GTSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggactcggaatattacagcggcgaccagtcagcagatgatggtggcgctaccccagta
caggatgaacgggattcagggtcagacgttgaggatgatgtaaatgagcagcactctgga
tcagacactggaagtgtagaacgtcattcagagaatgaacctagtgatcgagaagatggt
ctcaacaaaagacatcatgtgacagactctgagaacgatgacccctcaaatcttaatgcc
agtgactctgaaagtgaggagcttcaaaggcaaaaggacagcgactctgaattcgaaggg
catgcagagcctcctgcgagtgattctgaaaacgaggatgccaatcaccatgggagcgac
tctgagaatgaggagcccaggaagttacctgtgagcgactctgaaaacgaggagctgctt
aatgggcacgccagcgactccgaaaatgaagatgttaggaagccccctgccagcgattca
gaggttgaagagctccccaaaagtcctgccagttactcggaaacagaggatgctctaaaa
ccccaagtcagtgactctgagagtgaggagcccccaagacacccagccagtgactcggaa
aatgaggagcttcccaagcctcgagttagtgactctgaaagtgaggagcttcccaagcct
cggatcagtgactcagaaagcgaggacccgccaaggcagcaagccagcgactcggaaaat
gaagagcttcccaaaccccgtatcagtgattcggaaagtgaggaccccccaaggcaccaa
gccagtgactcggaaaatgaggagcttcccaaaccccgaattagtgattcggaaagcgag
gacccgccaaggcaccaaaccagtgattctgaaaatgaggagcttcccaagccccaagcc
agtgactctgagagcgaggagcctcagaaggggcctgccagcgattcagaagctgaggct
gcccccggacacagacagaagccggtgtctgatgaggacagtgacggggagaataagaga
gaggacacagaaatgcaggctgacccccttcattcagatgcccatgtagacaggaagcgg
ttcagcagttctgacagcgaggaggaagaaccaaaaaggcccaaaatcgacagtgatgag
gatgaagaaaaagagggggtggaggagaaagtagcaaagcggaaagctgctgtgctttct
gatagtgacgatgaagaaaaagcatcaacaaagaagagtcgtgttgtctctgatgcagat
gactctgacagtgatgttatgtcggataaatcaggcaaaagagagaagacgatagcatct
gacagtgaagaagaagcagggagagaattgtctgataagaaaaatgaagagaaggacctc
tttgggagtgatagtgagtcagggaatgaagaagaaaatcttattgcagacatatttgga
gaatctggtgatgaggaggaggaagaatttacaggttttaaccaagaagatttggaagaa
gaaaaaagtgaaacacaggtaaaagaagcagaagattcagattctgatgataacataaag
agaggaaaacacatggactttctgtcggactttgagatgatgttgcagcggaaaaagagc
atgagtggcaagcgcaggcgtaaccgtgatggtggtacttttattagtgatgccgacgac
gttgtgagcgccatgattgtcaagatgaatgaagctgctgaggaagacagacagttgaat
aatcaaaaaaagccagcactgaaaaaattaacattattacctactgtggtcatgcacctt
aagaagcaggaccttaaagaaacatttattgacagtggtgtgatgtctgccatcaaagaa
tggctctcccctctaccagataggagtttgccggcactaaagattcgagaagagctgttg
aagattctgcaagagctacctagtgtgagccaggagaccctgaagcatagtgggattgga
cgagcagtgatgtatctttataaacaccccaaggaatcaaggtccaacaaggacatggca
gggaaattaatcaatgaatggtctcggcctatatttggtcttacctcaaactacaaagga
atgacaagagaagaaagggagcagagagacctagaacagatgcctcaacggcgaagaatg
aacagcactggtggtcagacaccccgaagagatttggaaaaggtgctgacaggcgaggaa
aaggctcttagacctggagatcctggattctgtgcccgggcaagggtccccatgccctcg
aacaaggactatgttgtcaggcccaagtggaatgtggaaatggagtcgtccaggtttcag
gggacctccaagaagggtatcagtcgactggataaacagatgagaaagttcacagacatc
aggaaaaaaagcagatctgcacacgcagtaaaaatcagcatcgagggcaataaaatgccc
ttgtga

DBGET integrated database retrieval system