KEGG   Delphinapterus leucas (beluga whale): 111183554Help
Entry
111183554         CDS       T05885                                 

Gene name
PPIF
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase F, mitochondrial
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04020  Calcium signaling pathway
dle04022  cGMP-PKG signaling pathway
dle05012  Parkinson disease
dle05016  Huntington disease
dle05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111183554 (PPIF)
   04022 cGMP-PKG signaling pathway
    111183554 (PPIF)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111183554 (PPIF)
   05016 Huntington disease
    111183554 (PPIF)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111183554 (PPIF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dle03110]
    111183554 (PPIF)
Enzymes [BR:dle01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111183554 (PPIF)
Chaperones and folding catalysts [BR:dle03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111183554 (PPIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 111183554
NCBI-ProteinID: XP_022446699
UniProt: A0A2Y9PID9
Position
Unknown
AA seq 205 aa AA seqDB search
MLALRCGPRLLGPLSGPRSAHLRLPAARACSSGSRDPSSSSRNPLVYLDVGADGQPLGRV
VLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGRSIYG
SRFPDENFKLKHKGPGVLSMANAGPNTNGSQFFICTTKTDWLDGKHVVFGHVKEGMEVVK
KIESLGSKSGKTSKKIVITDCGQVS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctacgctgcggcccccgtctgctcggccccctctccggcccgcgctctgcg
cacctgcgcctacccgcggcccgcgcttgcagcagcggctcccgagacccgtcctcttcc
tcccggaacccgctcgtgtacctggacgtgggcgccgacgggcagccgctcggccgcgtg
gtgctggagctgaaggcagatgtcgtcccaaagacagcagagaacttcagagccctgtgc
accggggagaagggcttcggctacaaaggctccacctttcacagagtgattccgtccttc
atgtgccaggctggggacttcaccaaccacaacggcacaggggggaggtccatctacggg
agccgctttcctgacgagaacttcaaactgaagcacaaggggccaggtgtcctgtccatg
gcaaatgcaggccccaacacgaacggctcccagttcttcatttgcaccacaaagacagac
tggctggatggcaaacatgttgtgtttggccatgtcaaagagggcatggaagtcgtgaag
aaaatagaatctctcggctccaagagtgggaagacatccaagaagattgtcatcacggac
tgcggccaggtcagctaa

DBGET integrated database retrieval system