KEGG   Delphinapterus leucas (beluga whale): 111184129
Entry
111184129         CDS       T05885                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dle01002]
    111184129 (ERAP1)
Enzymes [BR:dle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     111184129 (ERAP1)
Peptidases and inhibitors [BR:dle01002]
 Metallo peptidases
  Family M1
   111184129 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 111184129
NCBI-ProteinID: XP_022448012
UniProt: A0A2Y9PQY7
Position
Unknown
AA seq 942 aa
MIPLSVKRPLVTISLLLSSLLMLLTVATPSWCQSSETTSPKASNRAPFPWNKMRLPEHII
PLHYDLMIHANLTTLTFGGTTEIEITASKPTSTIILHSHHLQISKAALRKGAGERQSEEP
LRVLEYPPQEQIALLAPEPLVVGLLYTIVIDYAGNLSESFYGFYKSTYRTKEGEMRILAS
TQFEPTAARMAFPCFDEPAFKASFSIKVRREPRHFAISNMPLVKSVTVAEGLVEDHFDVT
VKMSTYLVAFIVSDFKSVSKMTKSGIKVSVYAVPDKINQAGYALDAAVTLLEFYEDYFSI
PYPLSKQDLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFDKCFNAMEVDALNSSHPV
STPVENPAQIREIFDEVSYEKGACVLNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLW
NSMASICPTDGTQQMDGFCSRGEHSTSSSHWRQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYVKGPDDAPETGYLWHVPLTFITSNSDSVQRFLLKTRTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSSDRASLINNAFQLVSIGKLSIEKALD
LTLYLKRETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIGLLRDLIDKQTWTDE
GSISERMLRSQLLLLACVRKYQPCVQKAEGYFRQWQEANGNLRLPSDVTLAVFAVGAQNP
EGWDFLYSKYQSSLSSTEKRQIEFALCITHNKEKLQWLLDQSFKGDTIKTQEFPDILRTI
GRNPVGYPLAWQFLRENWNKLVQKFELGSSSIAYMVVGTTNQFSTRARLEEVKEFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQNEKLELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatacctctgtctgtcaaacggccccttgtgaccatatcccttctgctttcatcactg
ttgatgctcttaactgtggcaactccatcctggtgtcagagcagtgaaacaacatctcca
aaggctagtaacagggcaccatttccttggaataaaatgcgacttcctgagcacatcatc
ccacttcattacgatctcatgattcatgccaacctcaccactctgactttcgggggaacc
acggaaatagaaatcacagccagcaagcccaccagtaccatcatcctgcatagtcaccac
ctgcaaatatctaaggccgccctgaggaagggagctggtgagaggcagtctgaagagccg
ctgagagtcctggaatacccgcctcaggagcaaatcgcactcctggctcctgagcccctg
gtggtcgggctcctgtacaccattgtcattgactatgctggcaatctttctgagagtttc
tatggattttataaaagcacctacagaaccaaggaaggggaaatgaggatacttgcatca
acacagtttgaaccgactgcggccagaatggcctttccctgctttgatgaacctgctttc
aaagcgagtttttcaatcaaggtcagaagggaaccaagacacttcgccatctccaacatg
ccactggttaaatctgtgactgttgctgaaggactcgtagaagaccattttgatgtgacc
gtgaagatgagcacctacctggtggccttcattgtttcagattttaagtctgtcagcaag
atgaccaaaagtggcatcaaggtttccgtgtatgctgttccagacaagataaatcaggca
ggttatgcactggatgccgcggtgactcttctagaattttatgaggattatttcagcatt
ccatatcccttatccaaacaagatcttgccgctattcctgactttcagtctggtgctatg
gaaaactggggactgacaacatacagggaatcttctctactgtttgatgctgaaaagtct
tctgcatcaagtaagcttggcatcacgatgactgtgtcccatgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagttcgtgtctgtcagtgtgactcatccagaactgaaagttgaagattat
ttctttgataagtgttttaatgctatggaggtagatgcattaaactcctcacaccctgtg
tccacacctgtggagaatcctgctcagattcgggagatatttgatgaagtttcttatgaa
aagggagcttgtgttctgaatatgctgagggattatcttggtgccgatgcatttaaaagt
ggtattgtaaagtatctgcagaagtatagctataaaaacacaaaaaacgaggacctttgg
aatagtatggcaagtatttgccctacagatggcacacaacaaatggatggattttgttct
agaggtgaacattcaacttcatcttcacactggcgacaggaaggccttgatgtgaaaacc
atgatgaacacctggacgcttcagaagggctttcccctgataaccatcactgtgagaggg
aggaatgtacacatgaagcaagagcactatgtgaaaggcccggacgacgccccagaaact
gggtacctgtggcatgtcccattgacattcattaccagcaactcagactcagtccagcga
tttttgctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgttggaatgaatggctattacatagtgcattatgaggatgatggatgggattct
ttgactggccttttaaaaggaacacacacggccatcagcagtagtgatcgggccagtctc
attaacaatgcttttcagcttgtcagcattggaaagctatccattgaaaaagccttggat
ttaaccttgtacttgaaacgtgaaactgaaatcatgccagtgttccaaggtttgaatgaa
ctgatacctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcagttc
aaggcctttctcatcgggctgctgagggacctcattgataagcagacttggacggatgag
ggctccatctcagagcgaatgctgcggagtcagctgcttctcctggcctgtgtgcgcaag
taccagccctgtgtgcagaaggcagaaggctatttcagacagtggcaggaagccaatggg
aatttgaggctgcccagcgatgtgaccttggcagtgtttgctgtaggggcccagaaccca
gaaggatgggattttctttatagtaaatatcaatcgtcattgtccagtacggagaaacgc
caaattgaatttgctctctgtattacccacaataaagaaaagcttcagtggctactagat
caaagttttaagggagatacaataaaaactcaagagtttccagatattcttagaactatc
ggcagaaacccagtgggatatccactggcctggcagtttctgagggaaaactggaataaa
cttgtacaaaagtttgaacttggctcaagttccatagcctacatggtagtgggaacaaca
aatcagttctcgacaagagcacggcttgaagaggtaaaagaattcttcagctctttgaag
gaaaatgggtctcagctccgttgtgtccagcaaacaattgaaaccattgaggaaaacata
cgttggatggataagaattttgataaaatcagagtgtggctacaaaatgaaaagcttgaa
ctgctgtaa

DBGET integrated database retrieval system