KEGG   Delphinapterus leucas (beluga whale): 111184524Help
Entry
111184524         CDS       T05885                                 

Gene name
PPIA
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase A isoform X1
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111184524 (PPIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dle03110]
    111184524 (PPIA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dle04147]
    111184524 (PPIA)
Enzymes [BR:dle01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111184524 (PPIA)
Chaperones and folding catalysts [BR:dle03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111184524 (PPIA)
Exosome [BR:dle04147]
 Exosomal proteins
  Proteins found in most exosomes
   111184524 (PPIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 111184524
NCBI-ProteinID: XP_022448826
UniProt: A0A2Y9PUE1
Position
Unknown
AA seq 164 aa AA seqDB search
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFDDENFLLKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccctaccgtgttctttgacatcgccgtcgacggcgagcccttgggccgcgtc
tccttcgagctgtttgcagacaaagttccaaagacagcagaaaacttccgtgctctgagc
actggggagaaaggctttggttataaaggttcctgctttcacagaataattccgggattt
atgtgccagggtggtgacttcacacgccataatggcactggtggcaagtccatttatggg
gagaaatttgatgatgagaatttcctcctgaagcatacgggtcctggcatcttgtccatg
gcaaatgctggccccaacacaaacggttcccagtttttcatctgcactgccaagactgag
tggttggatggcaagcatgtggtctttggcaaggtgaaagagggcatgaatattgtggaa
gccatggagcgctttggttccaggaatggcaagaccagcaagaagatcaccattgctgac
tgtggacaaatctaa

DBGET integrated database retrieval system