KEGG   Delphinapterus leucas (beluga whale): 111184752Help
Entry
111184752         CDS       T05885                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04218  Cellular senescence
dle04670  Leukocyte transendothelial migration
dle05200  Pathways in cancer
dle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111184752 (RASSF5)
   04015 Rap1 signaling pathway
    111184752 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111184752 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    111184752 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111184752 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    111184752 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA C1_1 C1_2 PHD
Motif
Other DBs
NCBI-GeneID: 111184752
NCBI-ProteinID: XP_022449300
UniProt: A0A2Y9PUV2
Position
Unknown
AA seq 422 aa AA seqDB search
MAMASPAIGQRPYRLLLDTEPPRYLQSLSGPKPPPPPPPPGRSSRRCAPAPLSTAPGAHE
GRGARRAARGDLEPQPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAE
RGEGHCFAELELRSGWGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGPSR
DRPSPESTLTSTFSQNDCTPAEEPWCPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTG
FIKVHLRLRRPVMVPAGIRPPSIYDAIKEVDLAATTDKRTSFYLPLDAIKQLHICSTTTV
SEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSVADCPLYLRLLAGPDTDVLSFV
LKENETGEVEVLLLQDGLRPIKPHPWAPLGMGIFESFVSPWFFKADLDPPREAHRSPVCG
VK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtaccggctactcttggacacagaa
ccgccgcgctatctacagagcctgagcggccccaagccgccgccgcctccgccgcccccg
ggccggtcctcgcgccgctgcgcccccgcgcccctctccactgcgcccggggcgcacgag
ggacgcggtgccagaagggctgcccggggggacttggagccacagcctcgggcttcccga
cccgctcgtccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccc
cggccccgagacgtgcggagcatcttcgagcagccccaggatccccgcgtcccggcggag
cgaggcgaggggcactgcttcgccgaactggagctgcggagtggctggggctggtgtgac
ctgtgcggacgagaggtgctgcgtcaggcgctgcgctgcactaactgtaaattcacctgc
cacccggagtgccgcagcctgatccagctggactgcagtcagcaggaaggcccctcccgg
gacagaccctctccagaaagcaccctcacttcgaccttcagccagaatgactgtacaccc
gcagaggagccgtggtgcccgcccacgctgcaggagatcaagcagaagatcgacagctac
aacacccgggagaagaactgcctgggcatgaagctgagtgaagacggcacctacacgggt
ttcatcaaagtacatctgagacttcggcggccagtgatggtgcctgctgggatccggccc
ccgtccatctatgacgccatcaaggaagtggacctggcagccaccacggacaagcggaca
tccttctacctgccgctggacgccatcaagcagctgcacatctgcagcaccaccacggtc
agtgaggtcatccaggggctgctcaagaagttcatggtcgtggacaatccccagaagttt
gcactttttaagcggatacacaaggacgggcaagtgctcttccagaaactctccgttgct
gactgccccctctacctgcgcttactcgctgggcctgacacggatgtgctcagcttcgtg
ctaaaggagaacgaaactggagaggtggaggttcttttgctccaggatggcctgaggccc
atcaagccccatccctgggctccactgggcatgggtatttttgagtcatttgtctctccc
tggttcttcaaagcggacctcgatcccccaagggaagctcaccggagtccagtctgtggt
gtgaagtga

DBGET integrated database retrieval system