KEGG   Delphinapterus leucas (beluga whale): 111184786Help
Entry
111184786         CDS       T05885                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00562  Inositol phosphate metabolism
dle01100  Metabolic pathways
dle04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111184786 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111184786 (PIK3C2B)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     111184786 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 111184786
NCBI-ProteinID: XP_022449401
UniProt: A0A2Y9PW33
Position
Unknown
AA seq 1634 aa AA seqDB search
MSSTQGSGDHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEESRAKQNTDPSLISW
DEPVLDFYSKPAGRRKDLKLLRGLSGSDPTLNYNSLSPQEGLPNHSTSQGSQPGADPWPK
ASLAGDYLYIFDGSDGGLSLSPGLGDTDDSLKKLSPPPLPPRVSIWDTPPLPPRKGSPSS
SKISQPNDINTFSLVEQPPGKLLGHQLLEEEEELGGGGPGRLLGSMDYDGINDAITRLNL
KSTYDAEMLRDATRGWKDGRGLLNFGKDTPGKPVARSKTMPPQVPPRTYTSRYANRKNGT
SGKNLQISAAPVGSRPHTIANGHELFEVSEERDEEVAAFCHMLDILRSGSDVQDYSLTGY
VWSTVTPSPEHLGDEVNLKVTVLCDSLQEPLTFTCNCSSTVDLLIYQTLCYTHDELRGVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKAVRGDLARTVNDDQS
PSTLNYLIHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITNALNQLPPCPSRMKPKIQKDPTILAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAVHGSRKHDLVQEACHFSGPLAFTVYATHRIPIIWATSYEEFYLSCSLSH
GGKELCSPLRTRRVHFSKYLFHLIIWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSS
SESNKQRRVPEALGWVTAPLFNFRQVLTCGRKLLGLWPATQESPSTRWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPAGDKFSPRYEFGSLREEDQHVLKNIMQKESLYWLTDADKKSLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVSTLAKLAQQVREAAPSARPGILR
TGLEEVGQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRV
IFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVLFRCFSTGRGRGMVEMIPNSETLRK
IQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDN
IMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFAPRTHTLKSSGRISDVFLCRHEKIFH
PNKGYIYVVKVMRENAHEAAYIQRTFEEFQELHNKLRLLFPSSLLPSFPSRFVIGRSRGE
AVAERRREELNGYIWHLIHAAPEVAECDLVYTFFHPLSRDEKAAGTSLAPKSSDGTWARP
VGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKKKTKV
ARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVHIRLRELDLAQEK
TGWFALGSRSHETL
NT seq 4905 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcagtggggatcattggaagtcactggagtctgtgggcatcagc
cgcaaagagctggccatggccgaagccctgcagatggagtatgatgctctgtcccggctt
cggcacgacaaggaggaaagcagagccaagcagaacacagacccctctctcatcagctgg
gatgagcctgtcctagacttctacagcaagccagcgggaaggcggaaggacctcaaactc
ttacgtggtctctctggctctgaccctaccctcaattacaactcgctctccccacaggaa
gggctgcccaaccactctacctcccagggctcccagcctggcgcagatccctggcccaaa
gcctccctggccggagactatctctacatttttgatggttcagatggggggctctctttg
tccccaggactgggggacacagacgactctttgaagaaactgtccccacctcctctgcct
ccccgagtctctatctgggacactcctcccctgcctcccagaaaggggtccccctcatcc
tccaagatctcccagcccaatgacatcaacactttttctttggtcgaacaacctccaggc
aaactgctggggcatcagctcctagaagaggaagaggagctgggaggtgggggtccaggg
cgcctactggggtccatggactacgacggtatcaatgatgccattacacggctcaacttg
aagtcaacctatgatgcagagatgctgcgggacgccaccaggggctggaaggacggccgg
ggactcctgaactttggcaaggacactcctggaaaacctgtggcccggagcaagaccatg
ccccctcaggtgcccccccgcacctacacctcccgctacgccaaccggaaaaatggaaca
tctggcaagaacctccagatttctgcagctccggtgggctcccggccccacaccatcgcc
aatggccatgagttgtttgaggtctcagaggagagagatgaagaagttgctgcattctgc
cacatgctggatatcctccgatctggctctgatgtccaagactactccctcactgggtat
gtctggagcactgtcaccccaagcccagagcacctcggggatgaggttaacctgaaggtg
accgtgttgtgtgacagcctgcaggagccactcacttttacctgcaactgttcctccact
gtagacttgctcatctaccagaccctgtgctatacccatgatgaactgaggggtgtcgat
gtgggtgacttcgtgctaaagccctgtgggctggaggaattcctgcagaacaagcacgcc
ctgggcagccacgagtatattcaatactgtcgaaagtttgacatcgacattcggctacag
ctgatggagcagaaagctgtacgcggtgacctggcccggacggtgaatgatgaccagagc
ccctccaccttgaactacctcatccatctgcaagagaggccagtcaagcagaccatcagc
aggcaggccctgagtcttctgtttgacacttaccacaatgaggtggatgccttcctgttg
gctgatggtgactttccactgaaggccgacagggtggtccagtccgtcaaggccatctgc
aacgccctagccgctgtggaaacccctgagatcaccaacgctctcaaccagctgcccccc
tgcccttcccgaatgaagcctaaaattcagaaggatcccaccatcttggctgtgagggaa
aaccgagagaaggttgtggaagccctgacagctgccatcttggacctggtggagctgtac
tgcaacacgttcaatgcagacttccagacagcagtgcacgggagccgcaagcatgatctg
gtccaggaggcctgccatttttctgggcccctggcctttacggtctatgccacccaccgc
atccccatcatctgggccaccagctatgaagagttctacctctcctgctccctcagccat
ggcggcaaggagctgtgcagccccctgcggacccgaagggttcacttctccaagtacctc
ttccacctcatcatctgggaccagcagatctgcttccctgtgcaggtgaaccggttgcct
cgggagaccctgctgtgtgccactctctatgctctgcccatccccccacccgggagttcc
tcggagtccaataagcagcggcgggtgcccgaagccctgggctgggtcactgctccgctc
ttcaacttcaggcaagtcctgacctgtggccggaagcttctgggcttatggccagcaaca
caggaaagccccagtacccgttggagtgcacctaatttccatcagccagatagtgtcatc
ctgcagattgactttcccacctcagccttcgacatcaagttcaccagccccgctggagac
aagttcagcccccgctatgagtttggcagcctccgggaggaagaccaacacgtgcttaaa
aacatcatgcagaaggagtccctgtactggctcactgatgctgacaaaaagagcctgtgg
gagaagcggtattattgccactcggaggtgagctcactccccctggtgctcgctagcgcc
cccagctgggagtgggcttgcctgcccgacatctacgctctcctgaagcagtggacccac
atgaaccaccaggatgccctggggctcctgcatgccacgttcccagaccaggaggtgcgt
cgtatggctgttcagtggattggctccctctctgatgctgagctgttggactacttgccc
cagctcgtgcaggccttaaagtatgagtgctacctggacagccccttggtgcgcttcctc
ctgaaacgagctgtctctgacttgagagtgactcactacttcttctggttgctgaaagac
ggcctcaaggactctcagttcagtatccgctaccagtatctgctggcagccttgctgtgt
tgctgtggcaaggggctgagagaggagtttaaccgccagtgctggcttgtcagtaccctg
gccaagctggcccagcaggtccgggaggctgccccgtccgcacggccggggattctccgc
acgggcctggaggaggtggggcagttttttgccctcaatggctcctgccgcctgccgctt
agccccagtctgctggttaagggtatcgtgcccagggactgctcctacttcaactccaat
gcagtccccctcaagctctccttccaaaatgtggatccgctgggcgagaacatccgtgtc
atcttcaagtgtggggacgaccttcgccaggacatgctgaccctacagatgatccgcatc
atgagcaagatctgggtccaggaggggctggacatgcgcatggtcctcttccgctgcttc
tccactggccgtgggagagggatggtagagatgatccccaactctgagaccctgcgcaag
atccaggtggagcacggggtgactggctccttcaaggaccggcccctagccgactggttg
cagaagcacaaccctggggaggacgagtacgagaaggccgtagagaacttcatctattct
tgtgctggctgctgtgtggccacgtacgtcttgggcatctgtgaccgtcacaatgacaac
atcatgctgaagacgactggccacatgttccacatagattttggccgtttcctgggccac
gcccagatgttcgggaacatcaagcgggaccgtgccccctttgtcttcacctcggacatg
gcgtatgtcatcaacgggggtgacaagccttccagccgcttccatgattttgttgacctt
tgctgccaagcctacaacctcattcgcaagcacacccacctcttcctcaaccttctgggc
ctgatgttgtcctgtgggatccctgagctctcagacctggaagacctcaagtatgtgtat
gatgccctgaggcctcaggacacagaggccaatgccactacctacttcaccaggttgatt
gagtccagccttggcagcgtagccacaaagctcaattttttcattcataacctggctcag
atgaagttcacaggctcagacgaccggctgaccctttcctttgctccccgaacacacact
ctcaagagctctggccgcatcagtgatgtatttctctgccgccacgagaagatcttccac
cccaacaaaggctacatttatgtggtaaaggtgatgcgagagaatgctcacgaggccgct
tacatccagaggacatttgaggagttccaggagttacacaataagctgcggctgctcttc
ccttcttccctcctgcccagcttccctagtcgctttgtgattggccgctcacggggagag
gcggtggcggagcggcggagagaggagttaaatggctacatctggcacttgatccacgca
gcccctgaggtggccgagtgtgatttggtgtacaccttcttccaccccctgtcccgggat
gagaaggctgcgggcaccagcctggctcccaagtcctcagatggcacatgggcccggccg
gtcgggaaggttgggggagaggtgaagctgtccatctcctacaaaaacaacaaactcttc
atcatggtgatgcatattcggggcttgcaactgctccaggatggaaatgatcccgacccc
tatgtcaagatttacctccttcctgaccctcagaaaaccactaagaagaaaaccaaagtg
gcccggaaaacctgcaaccccacctacaatgagatgctggtatatgatggaatccccaag
ggagacctgcagcagcgggagctacagctcagtgtgctgagtgagcaaggattctgggag
aacgttctgctgggggaggtgcacatccgcctgcgagagctggacctggcccaggagaag
accggctggttcgcactggggtctcgaagtcatgagacgttatga

DBGET integrated database retrieval system