KEGG   Delphinapterus leucas (beluga whale): 111186858Help
Entry
111186858         CDS       T05885                                 

Gene name
CAMKK2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2 isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04140  Autophagy - animal
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04920  Adipocytokine signaling pathway
dle04921  Oxytocin signaling pathway
dle05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    111186858 (CAMKK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111186858 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111186858 (CAMKK2)
   04921 Oxytocin signaling pathway
    111186858 (CAMKK2)
  09149 Aging
   04211 Longevity regulating pathway
    111186858 (CAMKK2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    111186858 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dle01001]
    111186858 (CAMKK2)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111186858 (CAMKK2)
Protein kinases [BR:dle01001]
 Serine/threonine kinases: Other
  CAMKK family
   111186858 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 APH
Motif
Other DBs
NCBI-GeneID: 111186858
NCBI-ProteinID: XP_022453531
UniProt: A0A2Y9Q7J2
Position
Unknown
AA seq 580 aa AA seqDB search
MSSCVSSQPSSDRAAPQDELGGGSGNSNSSEGQKPCEALRGLSSLSIHLGMESFIVVTEC
EPACAVDSGLARDRPLEAPGGEVPLNVSGSQARPHLSSRKLSLQERSLLDANGRCVYPAL
PHSPVGSPQSSPRLPRRPTVESHHVSITGLQDCVQLNQYTLKDEIGKGSYGVVKLAYNEN
DNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPRGCIQPRGPIEQVYQEIAILKKLDHP
NVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQ
KIIHRDIKPSNLLVGEDGHVKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIF
SGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKDLITRM
LDKNPELRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVIL
VKTMIRKRSFGNPFEGSRREERSLSAPGNLLIKKPTRECEPLSEPKEARQRRQPPGPRPA
SRGGGGSALVKGGPGVESRGALAPGSGKRTHPPWPDEVME
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgcgtctctagccagcccagtagcgaccgggccgccccccaggatgagctg
gggggcggaagcggcaacagtaatagcagcgaaggccagaaaccctgtgaagccctgcgg
ggcctctcgtccctgagcatccatctgggcatggagtccttcatcgtggtcactgagtgc
gagccggcctgcgctgtggacagcggcctggcccgggaccggcccctggaggcccctggc
ggagaggtccccctcaacgtctccgggtcccaggcccggccccacctctccagtcgcaag
ctctctctgcaggagcggtccctgctggatgcgaatgggcgctgcgtctacccggccctg
ccccactcgcccgtgggctctccgcagtcctcgccgcggctgccccggaggcccacggtg
gagtcgcaccacgtctccatcaccgggttgcaggactgtgtacagctgaatcagtacaca
ctgaaggacgaaattggaaagggctcctatggcgtggtcaagctggcctacaatgaaaat
gacaatacctactacgcaatgaaggtgctgtccaaaaagaaactgatccgacaggcgggc
tttccacgtcgtccgcctccccgagggacccggccagcccccaggggctgcattcagccc
aggggccccattgagcaggtgtaccaggaaattgccatcctcaagaagctggaccacccc
aacgtggtgaagctggtggaggtcctggatgaccccaatgaggaccatctgtacatggtg
tttgaactggtcaaccaagggcctgtgatggaagtgcccaccctcaaaccgctctctgaa
gaccaggcccgtttctatttccaggatctgatcaaaggcatcgagtatttacactaccag
aagatcatccaccgggacatcaaaccttccaacctgctggttggagaagatgggcacgtc
aagattgcggactttggcgtgagcaacgagtttaagggcagcgatgccctcctctctaac
accgtgggcactcccgccttcatggcgcctgagtcgctctcagagacccggaagatcttc
tctgggaaggcgctggatgtttgggccatgggtgtgacgctgtactgctttgtgtttggc
cagtgcccattcatggatgagcggatcatgtgtttacacagtaagatcaagagtcaggcc
ctggaatttccagatcagcctgacatagccgaggacttgaaggacctgatcacccgcatg
ttggacaagaaccccgagttgaggatcgtggtgcctgagatcaagctgcacccctgggtc
acgaggcatggggcggagccactgccatcagaggatgagaactgcacgctggtcgaggtg
acagaagaggaggtggagaattcggtcaaacacatacccagcctggcaaccgtgatcctg
gtgaagaccatgatacgaaaacgctccttcgggaacccgtttgagggcagccggcgggag
gagcgctcgctgtcagcgcctggaaacctgctcatcaaaaaaccaaccagggagtgtgag
cccctgtctgagcccaaggaagcaaggcagcgaagacagcctccggggccccgacccgcc
tctcgtgggggaggaggaagcgctcttgtgaaaggcggcccaggggtggagagtcggggg
gccctggcccccggctccggcaagcggacgcatcctccgtggccggacgaggtgatggag
tag

DBGET integrated database retrieval system