KEGG   Delphinapterus leucas (beluga whale): 111187454
Entry
111187454         CDS       T05885                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
dle  Delphinapterus leucas (beluga whale)
Brite
KEGG Orthology (KO) [BR:dle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dle03021]
    111187454 (AFF3)
Transcription machinery [BR:dle03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111187454 (AFF3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 111187454
NCBI-ProteinID: XP_022454883
UniProt: A0A2Y9QHI4
Position
Unknown
AA seq 1160 aa
MKDFLTDRSNQSHLVGVPKPGVPQAPVNKIDEHFVADSRAQTQPASVCSTTSSTPAVVPG
QQSKRGTVGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQDR
PPAMGAKHSGSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPNESPKLKSSTETS
VHCASYRGASAAKPESARTKAKLAKFSIPKQGEESRSGETNSCVEEIIREMTWLPPLSAI
PAPGKVEPSKFPFPNKDSQLTSSGHSNPKKGDAEPGSPDNGTSNTSSLGWLSPFTDKGND
ALRGMLEDDLKLSSDEEENEQQAAQRTALHALSDSAGLPQANCRASVPSSKGSSSGSSSS
GSSSSSDSESSSGSDSETESSSSESEGSKPPHYSSPEAEPASSNKWQLDKWLNKVNPHKP
PILIQNESHGPEGNQYYTPVKDEAPDCGKLPDNVCPTSLRDKDIKSACKEEQRPRTANKA
PGSKGVKQKSPPAAVAVAVTAAAPPPTVAGAPAESAPAPARRSAGKKPTRRTERTSAGDN
GHRPEEPAAADALGASAGIPPEPPKPRPCGNSRTSHRKELRSAVTGEKRRTRGLSRIVPK
SKEFIETESSSSSSSADSDLESEQEDYPLSKATAASGNDPRLKEAASSISGGGPRAPVGS
INARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQE
PGVLSAPAAKDTESAPPNHASDAPAEKALPKSKRKRKCDSEDDCREIRKAQGEKESSSRL
TASASSTLSANHCNVNVNSLAIPINKNEKMLRSPTSPLSDASKHKYPGEDLTSPSRSNSN
GLFTSASSNKKHKAENQLQTRGGDLTKAAHSNSENVLHKSRPQTEPWSPGSNGHRDCKRQ
KLIFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESK
SPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKY
SKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPTSSVGSQGSLSNGNALSPST
IVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSME
HLVQYSQQGLHWLRNSTHLT
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgaaagacttcttaacggatagatcgaatcagagtcatctcgttggcgttcccaaacct
ggggttcctcaggctcccgtgaacaagattgacgagcattttgttgcagattcgagagcc
cagacccagcctgcatccgtctgcagcaccacatcctccaccccagcagtggtccctggg
cagcagagtaagaggggcaccgtgggctggcagaaggccgggcacccaccgtccgatggc
caacagagagcaacacaacagggctctctcaggaccttgctcggagatggtgttggcaga
cagcagccgcgggccaaacaggtgtgcaacgtcgaggtgggtcttcagacccaggacagg
ccacctgctatgggagccaagcacagcggcagtggccactgtgttcagaactttcctcca
tccctggcttcaaagcctagcctcgtccagcagaaaccgaccgcctatgtgcggccgatg
gatggccaagatcaggctcccaatgagtctccgaagctgaagtcgtccacagagaccagc
gtgcactgtgcgtcatacaggggagcctcagccgcgaagccagagtctgccagaaccaag
gccaagcttgccaagttcagcatccccaaacaaggagaggagagtagatctggagaaacc
aacagctgtgttgaagaaataattcgggagatgacctggcttccaccactttcagctatt
ccagcacctggaaaagtggaaccgagcaaatttccatttccaaataaggactctcagctc
acttcctcgggacacagtaatccaaagaaaggtgatgctgagccagggagtccagacaat
ggcacatcgaatacatcctctctgggatggttatccccatttactgataagggaaatgat
gcactgagaggaatgctagaagatgaccttaagctaagtagcgatgaagaggagaatgaa
cagcaggcagcccagagaacggctctccacgctctgtctgacagtgccggcctcccgcag
gccaactgcagggcctccgtgccctccagcaagggcagcagcagcggcagcagcagcagc
ggcagcagttcctccagcgactcggagagcagctcaggatctgactcagagaccgagagc
agctccagcgagagtgagggcagcaagcctccccactactccagccctgaggccgaacca
gcgtcctctaacaagtggcagctggataaatggctaaacaaagttaatccccacaagcct
cctatcctgatccaaaatgaaagccacgggccggagggcaatcaatactacaccccggtg
aaggacgaagcgccagactgcgggaagcttcccgacaacgtctgcccgaccagcctgaga
gacaaggacatcaagagcgcctgcaaggaggagcagaggccgaggaccgcgaacaaggcc
ccggggagcaaaggggtgaagcagaagtccccgcccgcggccgtggccgtggccgtgacc
gccgccgccccgccgcccacggtggccggtgcgcccgccgagagcgcgcctgcgcctgcc
cggaggtccgcgggcaagaaacccacgcggcgcaccgagaggacctccgccggcgacaat
ggccaccggcccgaggagcccgcagccgcggacgcgctgggggcgagcgcggggatcccc
ccggagccccccaagccccggccctgcggcaacagtaggaccagccaccgcaaggagctg
cgctcggccgtaaccggcgagaaacgccgcacgcgggggctgagccggatcgtccccaaa
tccaaggagttcatcgagaccgagtcgtcctcgtcgtcctcctccgcggactcggacctg
gagtcggagcaagaggactaccctctgtccaaggccactgccgcctccgggaacgacccg
aggctgaaggaggctgccagcagcatcagcggtggcggcccacgggcccctgtgggctct
atcaacgccaggaccaccagcgacattgccaaggagctggaagagcagttctacacattg
gtccccttcggccgcaatgaacttctctccccgttgaaggacagtgacgaggtcaggtca
ctctgggtcaaaattgacctgaccctcctgtccaggatcccagaacacctgccccaggag
ccgggggtcttgagcgctcccgcggccaaggacactgaaagcgccccgccgaaccacgca
tccgatgcgcccgcagaaaaggctttgccaaaatccaagaggaaacgcaagtgtgacagc
gaagatgactgccgggagatcaggaaggctcagggagagaaggagagctcttcacgactc
actgcgtccgccagcagtactttgtccgcaaaccattgcaacgtgaacgtcaacagcttg
gcaatcccaataaataaaaatgaaaaaatgctccgctcacccacctcacccctctccgac
gcatctaaacacaaataccccggcgaggacctgacttcccccagcagatccaacagcaat
ggtttgttcacctccgcctcgtccaacaaaaagcataaggctgagaaccagctacagacc
cgtggtggagacctcacgaaagcagctcacagcaattccgaaaacgttctccacaagtca
cggccacagacagagccatggtctccaggctccaacggccacagggactgcaagaggcag
aaactcatcttcgatgacatgccacgcagtgcagattattttatgcaagaagctaagcga
atgaagcataaagcagatgcaatggtggaaaagtttggaaaggctctgaactatgctgaa
gcagccttgtcattcattgagtgtggaaatgcaatggagcagggcccaatggaatccaaa
tctccttatacaatgtattcagaaacagttgagctcatcaggtatgctatgagactaaaa
acccactcaggccccaatgccacaccagaggataaacagctggctgcattatgttaccga
tgcctggctctcctgtactggcggatgtttcgactcaaaagggatcacgctgtaaagtat
tcaaaagcacttatcgactatttcaagaattcatctaaagctgcccaagccccatctcca
tggggggccagtggaaagagcactggcaccccatcccccatgtctcccaacccctccccc
accagctccgtgggatctcaggggagcctctccaatgggaacgccctgtccccatcaacc
atcgtcagcatcccacagcgcatccaccagatggcagccaaccacgtcagcatcaccaac
agcattctccacagctatgactactgggagatggcggacaacctggccaaggagaacaga
gaattcttcaatgacctggacctgctcatggggccagtcaccctgcacagcagcatggag
cacctggtccagtactcccagcagggcctgcactggctgcggaacagcacccacctgaca
tag

DBGET integrated database retrieval system