KEGG   Delphinapterus leucas (beluga whale): 111187681
Entry
111187681         CDS       T05885                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00230  Purine metabolism
dle00240  Pyrimidine metabolism
dle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111187681 (DCK)
   00240 Pyrimidine metabolism
    111187681 (DCK)
Enzymes [BR:dle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111187681 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_28 AAA_18
Other DBs
NCBI-GeneID: 111187681
NCBI-ProteinID: XP_022455271
UniProt: A0A2Y9QCG0
Position
Unknown
AA seq 378 aa
MRLRARGPAPPLPVTLCAGRARRGPARGGLRRRGPGGNSGLGEGGGVASPLGGRPLHSPA
SFGSCSRAPKSNPGTRWPESLPFKASSAAAAAAAQSRTPLTTSQRSLPDALGAATRRGMA
TPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCNVQ
STQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAEKP
VLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRATP
EKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTVKTNFDYLQEVPILTLDVNEDF
KDKHDSLVEKVKEFLSTL
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgcgcctgcgcgcgcgcggccccgcccccccgctccccgtgaccctttgtgctgggcgc
gcacgcaggggccccgcgcgaggcgggctccggcggaggggcccaggaggcaactcaggt
ttaggggaaggcgggggcgtggcttccccgctgggcgggcggccacttcacagtcccgcc
tcattcggcagctgcagccgcgcgccaaaatcaaacccgggtacccgctggccagagagt
ctgccgttcaaggcgagctccgcggcggcggcggcggcggcccagtcgcgcacacctttg
accacctcccagcgctccctgcccgacgcgctcggggccgccacaagacgaggcatggcc
accccacccaagaggagctgcccatctcccgcagccagctctgaggggacccgcatcaag
aaaatttccatcgaagggaacatcgctgccgggaagtcaacatttgtgaatatccttaaa
caagtctgtgaggattgggaagtggttcctgaacctgttgccaggtggtgcaatgttcag
agtactcaggatgaatttgaggaactgacaacgtctcagaaaagtggtgggaatgttctt
cagatgatgtatgagaaacctgaacggtggtctttcaccttccagtcatatgcctgcctc
agtcgaatacgagctcagcttgctgctctcaatggcaagctcaaagatgcagagaaacct
gtattattttttgaacgatctgtgtacagtgacaggtatatttttgcatctaatttgtat
gaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgactggatg
aataaccagtttggccaaagccttgaactggatggaatcatttatcttcgagccactcca
gagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcattcctctt
gaatacttagagaagcttcactataagcatgaaagctggctcctgcatagaacagtaaaa
accaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaagacttt
aaagacaaacatgacagtctggttgaaaaggtaaaagaatttttgagcactttgtga

DBGET integrated database retrieval system