KEGG   Dietzia lutea: A6035_03335Help
Entry
A6035_03335       CDS       T05442                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
dlu  Dietzia lutea
Pathway
dlu00903  Limonene and pinene degradation
dlu00930  Caprolactam degradation
dlu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dlu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A6035_03335
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    A6035_03335
Enzymes [BR:dlu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     A6035_03335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Hydrolase_4 COesterase
Motif
Other DBs
NCBI-ProteinID: AWH91362
UniProt: A0A2S1R531
Position
complement(767156..768235)
Genome map
AA seq 359 aa AA seqDB search
MSGSRPRHPGPPYDGGLRLPRSTGSGEVPQDGRRSSDREADRPSRRGPVLQGPAEQGTLR
SRGLAEALRLFVRPALDRMPATDASLGRLRTLTSGAGRAAALESTNDWSSDGPVPGLWVG
RKRFFDSDKVIYHVHGGGFTFGSPWSHKALASRIASETGVPVFLPDYRLAPEHPHPAATE
DTIAGWEWLIEMGFPAEDIVVAGDSAGGNLALQLVAYLERTRAPMPAGVVLLSPWIDLDF
TDMTERDRTRKDPFLALGLAELCRRQYAPGVDPDDPAISPINYEPSPDWPPFLIQAGGQE
IFRGGIERMAENFAEHGVRHEFQLWPDQFHVFQVFHPLVPEARVAVRDIGSFVRGCLRR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcacggccccgacatcccggcccgccgtacgacggtggcctccgactgcca
cgctcgaccgggtccggtgaggtcccccaggacggccgccgatcgtccgaccgcgaggcc
gaccgaccgtcccgacgagggcccgtcctccagggcccggccgaacaggggacgctgcgc
tcgcggggcctcgccgaggcgttgcgcctgttcgtgcgccccgccctggaccggatgccc
gccaccgacgcctcgctcgggcggctgcggaccctcacctcgggagcgggccgtgccgcc
gcgctggagagcaccaacgactggtcgtcggacgggccggtgcccggcctgtgggtgggc
cgcaagagattcttcgactccgacaaggtgatctaccacgtccacggcggcggcttcacg
ttcggatccccgtggtcacacaaggcgctcgcgtcccggatcgccagcgagaccggcgtc
ccggtcttcctgccggactaccggctcgcgcccgagcatccgcacccggcggccaccgag
gacaccatcgccggctgggagtggctgatcgagatggggttccccgccgaggacatcgtg
gtcgccggcgactccgcgggcggcaacctggccctgcagttggtggcctacctcgagcgg
acgcgggcgccgatgccggcgggcgtcgtgctgctctccccctggatcgatctggacttc
acggacatgacggagcgggaccggacacggaaggacccgttcctcgccctggggctcgcc
gaactgtgccgacgccagtacgcgcccggcgtggacccggacgatccggccatctcgccg
atcaactacgagccgtcgccggactggccgccgttcctcatccaggccggcggccaggag
atcttccggggcgggatcgagcggatggcggagaacttcgccgaacacggcgtgcgccac
gagttccagctgtggccggaccagttccacgtgttccaggtgttccacccgctcgtcccg
gaggcgcgggtcgcggtccgcgacatcgggtcgttcgtccgcggatgcctgcgccgctga

DBGET integrated database retrieval system