KEGG   Dietzia lutea: A6035_09610Help
Entry
A6035_09610       CDS       T05442                                 

Definition
(GenBank) methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
dlu  Dietzia lutea
Brite
KEGG Orthology (KO) [BR:dlu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dlu03009]
    A6035_09610
Enzymes [BR:dlu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     A6035_09610
Ribosome biogenesis [BR:dlu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A6035_09610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Ubie_methyltran Methyltransf_12 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AWH93885
UniProt: A0A2S1RC98
Position
complement(2134971..2135906)
Genome map
AA seq 311 aa AA seqDB search
MRATDKGVTCGSGHPFDRARQGYLSLFGPRGRRFPGDTADQVAARDRVLSTGLFDGVLDA
LAAVARDSLGAGVPQSSPHGAGAPDRAPHGAGAPDRTAHGAGAPAEPVSRRVVLEAGAGT
GHYLAGVLDAVSRARDGEGADVVGIGTEISAAAARRLARAHPAAAALVADTWDGLPLADD
SVDLVQVVFAPRNAPEFARVLRPGGALVVAVPGEGHLEPLRSAGGLLEPAPDKAARLDSE
LAGAFESGPVRVVDQRTEVPASVAVDLALMGPSGVHLDRARLEAALGADDQPVRLHVEVR
SYRVPLGDRWS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgaccgacaagggcgtcacgtgtgggtccgggcatccgttcgaccgggcccgc
caggggtacctcagcctcttcggcccccggggccggcgcttccccggggacaccgccgac
caggtcgcggcccgcgaccgggtgctgtcgacggggctcttcgacggggtcctcgacgcg
ctggcggcggtggcccgcgactccctcggcgccggagtcccgcagtcgtccccgcacggg
gcgggtgcgcccgaccgcgccccgcacggggcgggtgcgcccgaccgcaccgcgcacggg
gcgggtgccccggccgagcccgtctcccgccgcgtcgtcctcgaggcgggcgcgggaacc
ggccactacctcgccggggtcctcgacgccgtcagccgggcccgggacggggagggggcg
gacgtggtggggatcggcacggagatctccgcggcggccgcccgacggctggcccgggcg
caccccgcggcggccgcgttggtcgcggacacgtgggacgggttaccgctcgcggacgac
agcgtcgacctcgtgcaggtggtcttcgcgccccgcaatgcgccggagttcgcgcgggtg
ctgcgcccgggcggggcactggtcgtcgcggtgccgggggagggccatctcgagccgttg
cgttcggccgggggactgctcgagccggcaccggacaaggccgcgagactggactccgag
ctggcgggcgccttcgagtcgggcccggtgcgcgtcgtcgaccaacgcaccgaggtgccg
gcgtcggtcgccgtcgacctcgcgctcatgggacccagcggcgtgcacctcgaccgggcg
cggctggaggccgccctcggcgccgacgaccagccggtccgcttgcacgtcgaggtgcgt
tcctaccgcgtgccgctcggcgaccgctggtcctga

DBGET integrated database retrieval system