KEGG   Dietzia lutea: A6035_11440Help
Entry
A6035_11440       CDS       T05442                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dlu  Dietzia lutea
Pathway
dlu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dlu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A6035_11440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dlu03011]
    A6035_11440
Ribosome [BR:dlu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A6035_11440
  Bacteria
    A6035_11440
  Archaea
    A6035_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWH92680
UniProt: A0A2S1R8R7
Position
complement(2532912..2533349)
Genome map
AA seq 145 aa AA seqDB search
MSTDTKKTADGTVESEQKLTARATAKFVRVTPMKARRVIDLIRGKDASDALDILRFAPQS
ASEPVAKVLASAMANAENNLDLDPRTLVVTTAYADEGPTLKRFRPRAQGRAFRVRKRTSH
ITVEVTSVPEKAGAGRGRRNQGGAR
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgatacgaagaagaccgccgacggcacggtggagtccgagcagaagctcacc
gcgcgtgccaccgccaagttcgtccgcgtcacgcccatgaaggcgcgtcgtgtgatcgac
ctgatccgcgggaaggacgcgtccgacgcgctggacattctgcggttcgcaccgcagtcc
gccagcgagccggtcgccaaggtcctcgcctccgcgatggccaacgccgagaacaacctc
gacctggatccccggaccctcgtcgtgaccacggcctacgccgacgaggggccgaccctc
aagcggttccgcccgcgcgcccagggccgggccttccgcgtgcggaagcgcacgagccac
atcaccgtcgaggtgaccagcgtgcccgagaaggccggggccggccggggacgtcgtaac
cagggaggtgcccgctaa

DBGET integrated database retrieval system