KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0006Help
Entry
Dehly_0006        CDS       T01264                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00790  Folate biosynthesis
dly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dehly_0006
Enzymes [BR:dly01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Dehly_0006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase DUF561
Motif
Other DBs
NCBI-ProteinID: ADJ25346
UniProt: D8K327
Position
4502..5359
Genome map
AA seq 285 aa AA seqDB search
MKLTRHISELPPTTIGGVPFHWGCKTYIMGVLNVTPDSFSGDGLADDIDAAVVRARQLVD
QGADIIDVGGESTRPGAPEVGEDEEIHRVVPVIGRLKAELNIPVSVDTYKHRVAEEAALA
GADMINDVWGLKRDVGVARIAAEYNLPLIVTASQRDRRVKNIIPAVLRHLRWAIVKAEGF
GVSPDNIIVDPGFGFGKSVEQNLEVVRQLFRLKVLGKPILLGASLKSTIGRVLGDVPPSQ
RLEGTLAAHVVGIVGGADIIRVHDVEAHARAARVTDAIMRGWVDD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaccaggcatatttcagaattacctcccaccaccatcggcggagttcctttt
cactggggttgtaaaacttatatcatgggtgtactcaacgtcacgcccgattctttttcc
ggtgacggcttggccgacgatatcgacgccgccgttgtccgggccaggcaattagttgat
cagggcgcggatatcatcgatgtcggcggggaatccactcgcccgggcgctcccgaagtc
ggggaagatgaggaaatccatcgggtggtgccggtcatcggacgtctgaaagcggaatta
aatattcccgtcagtgtcgatacttacaagcacagggtagctgaagaagcggcattggcc
ggagccgacatgatcaacgatgtctggggtttgaaaagagatgtgggtgtcgcccggata
gcggctgaatataaccttccactgattgtgactgcttctcaacgtgacaggcgggtaaaa
aacataattcctgcggtcttacgacacctgcggtgggctatcgtaaaagcagaaggtttc
ggagtatctcctgataatattatcgttgatcccggattcggattcggtaaatcggtagaa
cagaatctggaagttgtccgtcaacttttccgtctgaaggtactgggcaagccgatattg
ttgggggcgtcactgaaatctacaattggcagagtcctgggggatgttccgccgtcccaa
cgtctggagggcacactggcggcacatgtcgttggtatcgtcggaggcgccgacatcatc
cgggtgcatgacgtcgaagcccatgccagagcggctcgggtgacggatgccatcatgaga
ggttgggtcgatgactga

DBGET integrated database retrieval system