KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0628Help
Entry
Dehly_0628        CDS       T01264                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00010  Glycolysis / Gluconeogenesis
dly00020  Citrate cycle (TCA cycle)
dly00620  Pyruvate metabolism
dly00633  Nitrotoluene degradation
dly00640  Propanoate metabolism
dly00650  Butanoate metabolism
dly00680  Methane metabolism
dly01100  Metabolic pathways
dly01120  Microbial metabolism in diverse environments
dly01130  Biosynthesis of antibiotics
dly01200  Carbon metabolism
Module
dly_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_0628
   00020 Citrate cycle (TCA cycle)
    Dehly_0628
   00620 Pyruvate metabolism
    Dehly_0628
   00640 Propanoate metabolism
    Dehly_0628
   00650 Butanoate metabolism
    Dehly_0628
  Energy metabolism
   00680 Methane metabolism
    Dehly_0628
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dehly_0628
Enzymes [BR:dly01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dehly_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_10 Fer4_4 Fer4_6 Fer4_17 Fer4_8 Fer4_13 IBD
Motif
Other DBs
NCBI-ProteinID: ADJ25937
UniProt: D8K009
Position
complement(592614..592910)
Genome map
AA seq 98 aa AA seqDB search
MAKAEHELTWKDIEIGAVVTEPGNAAIYKTGDWRSQKPDYDFKRCIKCGVCYIFCPEACI
HQNKAGFFEADFYYCKGCGICAYECPTRVITMREETEK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagcagagcatgaactgacctggaaagacattgagataggggctgtggtcacc
gaaccgggaaacgccgcgatttataaaaccggagattggcgatctcaaaaacccgattat
gactttaaaaggtgcataaaatgtggagtatgttacattttctgtccggaagcgtgtatt
catcagaataaagctggatttttcgaggcagatttctactattgtaaaggttgcggtatt
tgtgcctatgaatgccctaccagagtaattaccatgcgggaggaaacagaaaaataa

DBGET integrated database retrieval system