KEGG   Dehalogenimonas lykanthroporepellens: Dehly_0918Help
Entry
Dehly_0918        CDS       T01264                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00010  Glycolysis / Gluconeogenesis
dly00030  Pentose phosphate pathway
dly00051  Fructose and mannose metabolism
dly00052  Galactose metabolism
dly00680  Methane metabolism
dly01100  Metabolic pathways
dly01110  Biosynthesis of secondary metabolites
dly01120  Microbial metabolism in diverse environments
dly01130  Biosynthesis of antibiotics
dly01200  Carbon metabolism
dly01230  Biosynthesis of amino acids
dly03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_0918
   00030 Pentose phosphate pathway
    Dehly_0918
   00051 Fructose and mannose metabolism
    Dehly_0918
   00052 Galactose metabolism
    Dehly_0918
  Energy metabolism
   00680 Methane metabolism
    Dehly_0918
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dehly_0918
Enzymes [BR:dly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dehly_0918
Protein phosphatases and associated proteins [BR:dly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dehly_0918
Messenger RNA biogenesis [BR:dly03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dehly_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADJ26220
UniProt: D8K0U2
Position
906044..907012
Genome map
AA seq 322 aa AA seqDB search
MKKMAVLTSGGDAPGMNAAIRAVTRCGIAAGWRVIGINRGYRGLIAGDFRPLGIRDVSGI
IQAGGTILGSSRAPEFKTEAGRKQAMDNLHHDGISALVVIGGNGSQAGAHLLSQAEFPVV
GVASTIDNDLFGTDQSIGVDTALNIALEAIDRLKVTASSHQRAHIVEVMGRHQGYLALMA
GIAGGAEYVVLPELETSPEVIAEEIRKSYQRGKSHCLIVVAEGAEWNAERLINHFNTNAD
LGYSLRATILGHVQRGGAPTAFDRLLATRIGARAVEELDAGNHGVLLGLACGEIKPTPLE
TVAENTKQLDLSFLSVARKLTG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatggcggttctgacttctggcggcgacgccccgggcatgaacgcggccatc
agggcggttacccgatgcggcatcgccgctggctggcgggttatcggcatcaatcgtggt
tatcgggggctgatagccggagatttccggccgctgggcatcagggatgtttccggcatc
atccaggccggggggaccatcctgggttcctcccgcgcaccggaattcaagaccgaagcc
gggcgtaaacaagccatggacaacctgcatcatgatggcatctcagcgctggtggtcatc
ggcggcaacggctcccaggccggagctcacctgttgagccaggccgaatttccagtagtc
ggcgtggcctccaccatcgataacgacctgttcggcaccgaccagagcatcggggtagat
acggctctcaatattgcgctggaagccatcgaccgtctgaaggtcactgcctcatcccat
caacgggctcatatcgtcgaggtcatgggccggcaccagggatacctggcgctcatggcc
ggtatcgccggcggggcggaatatgtggtactgccggaactggaaaccagtccggaagtc
atcgctgaagaaatcaggaaaagttatcaacggggtaagtcccactgcctgatagtagtg
gccgaaggggctgaatggaacgcagaacgcctcataaatcatttcaataccaatgctgac
ctgggctattccctgcgggcaaccatattgggacatgtacaacgtggcggcgcgccgacg
gctttcgaccggctactggcgacccgcatcggcgccagggcagtcgaagaactggacgcc
ggcaatcatggcgtcctgctcggcctggcctgcggtgaaatcaagccgacaccgctggag
accgtggccgaaaacaccaaacagcttgatctctcctttctgtcggtggccagaaaactg
acaggttga

DBGET integrated database retrieval system