KEGG   Dehalogenimonas lykanthroporepellens: Dehly_1005Help
Entry
Dehly_1005        CDS       T01264                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dly  Dehalogenimonas lykanthroporepellens
Pathway
dly00010  Glycolysis / Gluconeogenesis
dly00030  Pentose phosphate pathway
dly00051  Fructose and mannose metabolism
dly00680  Methane metabolism
dly01100  Metabolic pathways
dly01110  Biosynthesis of secondary metabolites
dly01120  Microbial metabolism in diverse environments
dly01130  Biosynthesis of antibiotics
dly01200  Carbon metabolism
dly01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dehly_1005
   00030 Pentose phosphate pathway
    Dehly_1005
   00051 Fructose and mannose metabolism
    Dehly_1005
  Energy metabolism
   00680 Methane metabolism
    Dehly_1005
Enzymes [BR:dly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Dehly_1005
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Dehly_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3 LAGLIDADG_WhiA
Motif
Other DBs
NCBI-ProteinID: ADJ26306
UniProt: D8K128
Position
complement(1002941..1004035)
Genome map
AA seq 364 aa AA seqDB search
MKITLSVIKADIGGYVGHSDAHPECVCTADDALAKAKKSGLLIDYHTTKCGDDLQLIMTH
QRGENNADIHEMAWNTFVACTEVAKKHKLYGAGQDLLTDAFSGNIKGMGPGAAEMEFEER
TSEPVVVFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHQGFKFEVHDVKESKKITF
KTPEEIYDMLVFIGAANRYPIKSVYTLSGEIAASSSTQKLAFLAGRYVGKDDPVCIVRCQ
GSFPAVGEVLEPFAKPYLVEGWMRGSHYGPLMPVSVADSLPTRFDGPPRVTALGFQLAEG
RLVGPRDFFADVSYDQARQKANDMAYMMREHGPFEPHRLPLDEMEYTTMPQVSRKLEGRF
EPIE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagattactctgagcgtaatcaaggccgatatcggtggctatgtaggtcattcggat
gcccatccggagtgcgtctgtaccgctgacgacgctctggccaaggccaagaaaagtggt
ctgttgatagattatcacaccaccaagtgcggtgacgatctgcaacttatcatgacccat
cagcggggagagaacaatgccgatatccacgagatggcgtggaataccttcgttgcctgc
accgaagtggccaagaaacataaactctatggcgccggccaggacctgctgaccgatgcc
ttttccggcaatatcaaaggcatggggccgggcgcggccgaaatggagttcgaggaacga
acgtccgagccggtagtggtgttcatggctgacaagacatcatcgggtgcctggaacctc
ccgctgtacaagatgtttgccgatccatttaataccatcggtttggtaatcgccgagaac
atgcaccagggtttcaagtttgaggtgcatgacgtcaaggaaagcaaaaagatcaccttc
aagactccggaagagatatacgatatgctggtctttatcggcgcggccaaccgctatccc
atcaagtcagtctataccctgagtggagagatcgccgcctcgtcttccacccagaagctg
gcgtttctggccggccggtatgtcggcaaggatgacccggtgtgcatcgtccgctgtcag
ggttcctttccggcggtcggcgaagtcctggagccgttcgccaagccgtacctggtggaa
ggctggatgcgcggctcgcattacggcccgctgatgccggtgagcgttgccgacagtctg
ccgacccgtttcgacgggccgccaagggtaaccgccctgggcttccagctggcggagggc
cggctggtggggccgcgggatttctttgctgacgtgtcctacgatcaggctcgccagaag
gccaacgatatggcttacatgatgcgggaacatggcccgttcgaaccgcaccggttgccg
ctggatgagatggaatacaccaccatgccccaggtgtcgcgtaaactggaagggcgtttc
gagccaatcgagtaa

DBGET integrated database retrieval system